Produits biochimiques et réactifs

<p>Recombinant Human ICAM1 protein (His tag)</p>

<p>Norfluoxetine Conjugate for use in immunoassays</p>

<p>Mouse monoclonal FceRI alpha antibody (biotin)</p>

<p>Recombinant Human DBH protein (His tag)</p>

<p>OR2L3 antibody was raised in rabbit using the C terminal of OR2L3 as the immunogen</p>

<p>Mouse monoclonal VWA5A antibody</p>

<p>GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST</p>

<p>SLC25A32 antibody was raised using the middle region of SLC25A32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID</p>

<p>The CREB antibody is a highly effective tool for various applications in the field of Life Sciences. This polyclonal antibody is specifically designed to recognize and bind to the cAMP response element-binding protein (CREB), a transcription factor involved in regulating gene expression.</p>

<p>The TP53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the TP53 protein complex, which plays a crucial role in cell growth and apoptosis. This antibody has been extensively studied and has shown promising results in various research applications.</p>

<p>POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL</p>

DCI antibody was raised using a synthetic peptide corresponding to a region with amino acids ALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEP

<p>Rabbit polyclonal ABCD1 antibody</p>

<p>NSD3 antibody was raised in mouse using recombinant human NSD3 (383-660aa) purified from E. coli as the immunogen.</p>

<p>The RelB antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to RelB, a protein involved in the regulation of chemokine expression. This antibody is commonly used in studies investigating the role of RelB in various cellular processes. Additionally, it has been shown to be effective in detecting activated forms of RelB and can be used for immunohistochemistry and western blotting applications. The RelB antibody is buffered and available as both polyclonal and monoclonal antibodies. It can be used in combination with other antibodies or histone deacetylase inhibitors for more comprehensive research. With its high specificity and reliable performance, the RelB antibody is an essential tool for scientists studying the intricate mechanisms of gene regulation and signaling pathways.</p>

<p>SLC38A3 antibody was raised using the N terminal of SLC38A3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM</p>

<p>AKAP8 antibody was raised in rabbit using the middle region of AKAP8 as the immunogen</p>

<p>STK38L antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 38 Like (Stk38L)</p>

<p>Rabbit polyclonal Blimp 1 antibody</p>

Rat monoclonal CD44 antibody (biotin)

<p>C1S antibody is a monoclonal antibody that specifically inhibits the activity of C1S, an important protease involved in the complement system. This antibody has been designed to target and bind to the antigen, effectively blocking its function. The structural formula of this antibody allows for high affinity binding and stability, ensuring its effectiveness in pharmaceutical preparations. Studies have shown that the C1S antibody exhibits potent inhibitory effects on protease activity at low pH levels, making it an ideal candidate for therapeutic applications. Additionally, this monoclonal antibody has demonstrated efficacy in combination with other compounds and/or compositions, such as indomethacin and aminopyrine. Overall, the C1S antibody offers a promising approach for targeting and modulating immune responses mediated by the complement system.</p>

<p>Rabbit polyclonal ABHD14B antibody</p>

<p>ASPHD2 antibody was raised using the middle region of ASPHD2 corresponding to a region with amino acids YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL</p>

<p>Purified recombinant TNF protein (Bovine) (His tag)</p>

<p>BCL7C antibody was raised in Rabbit using Human BCL7C as the immunogen</p>

<p>ApoA-V antibody was raised in Mouse using Ni-NTA purified Recombinant human APOA5 expressed in Ecoli strain BL21 (DE3) as the immunogen.</p>

<p>The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.</p>

<p>Rabbit polyclonal POFUT1 antibody</p>

<p>Rabbit polyclonal TADA3 antibody (biotin)</p>

<p>Snf8 antibody was raised in rabbit using the N terminal of Snf8 as the immunogen</p>

<p>Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG</p>

<p>Purified recombinant POP7 protein (His tag)</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Purified recombinant SH3BGRL2 protein (His tag)</p>

<p>MAN1A2 antibody was raised in Rabbit using Human MAN1A2 as the immunogen</p>

<p>The TGM1 antibody is a polyclonal antibody that targets the transglutaminase 1 (TGM1) protein. This antibody is widely used in life sciences research to study the role of TGM1 in various cellular processes. TGM1 is an important enzyme involved in the crosslinking of proteins and plays a crucial role in the formation of the skin barrier. It is primarily expressed in epithelial cells and is essential for normal skin development and function.</p>

<p>Purified Polyclonal SERINC2 antibody</p>

<p>ARRB1 antibody is an antiviral agent that is commonly used in Life Sciences research. It specifically targets the ARRB1 protein, which plays a crucial role in various cellular processes. This monoclonal antibody can be used in assays to detect and quantify ARRB1 levels in samples. Additionally, it has neutralizing properties, meaning it can block the activity of ARRB1 and prevent its function. The ARRB1 antibody is produced using advanced techniques and high-quality excipients to ensure its stability and effectiveness. It has been extensively tested for specificity and potency, making it a reliable tool for researchers studying the function of ARRB1 in different biological systems.</p>

<p>CD11c antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD</p>

<p>Rabbit polyclonal Synuclein pan antibody</p>

<p>MMP19 antibody was raised in Rabbit using Human MMP19 as the immunogen</p>

<p>The CK18 antibody is a highly specialized monoclonal antibody that targets collagen in the body. Collagen is an essential protein that provides structure and support to various tissues and organs. This antibody specifically binds to collagen, allowing for targeted therapy and research applications.</p>

<p>Rabbit polyclonal TRIM17 antibody</p>

<p>Rabbit polyclonal SMA4 antibody</p>

<p>The AGPAT4 antibody is a monoclonal antibody designed for hybridization in the field of Life Sciences. It specifically targets and activates the AGPAT4 protein, which plays a crucial role in various biological processes. This antibody has been shown to interact with oncostatin, osteopontin, basic protein, e-cadherin, serum albumin protein, and β-catenin. By binding to these proteins, the AGPAT4 antibody can modulate their expression and function. Additionally, this antibody has demonstrated high specificity and affinity for human serum samples. It can be used in various research applications such as Western blotting, immunohistochemistry, and ELISA assays. The AGPAT4 antibody is an invaluable tool for scientists studying cellular signaling pathways and investigating potential therapeutic targets.</p>

<p>Saquinavir Mesylate (USP grade powder) chemical reference substance</p>

<p>Mouse monoclonal PGAM2 antibody</p>

<p>CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL</p>

<p>The ACY1 antibody is a monoclonal antibody that targets the ACY1 protein. ACY1 is an enzyme involved in various biological processes, including dopamine metabolism and apoptosis regulation. This antibody specifically binds to ACY1 and can be used for research purposes in the field of life sciences.</p>