Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.179 produits)
- Par Biological Target(99.902 produits)
- Par usage/effets pharmacologiques(6.790 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.846 produits)
- Métabolites secondaires(14.327 produits)
130590 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
AFP antibody
<p>The AFP antibody is a monoclonal antibody that targets the alpha-fetoprotein (AFP), a glycoprotein that is involved in various biological processes. This antibody specifically binds to AFP and can be used for diagnostic purposes, such as detecting the presence of AFP in blood samples. Additionally, the AFP antibody has shown potential therapeutic applications, particularly in the field of cancer treatment. It has been studied as an anti-HER2 antibody, inhibiting the growth factor receptor HER2 and potentially offering targeted therapy for HER2-positive cancers. The AFP antibody can also be used in research settings to study other proteins, such as alpha-synuclein or epidermal growth factor receptors. With its specificity and versatility, the AFP antibody holds promise in both diagnostics and therapeutics for various diseases and conditions.</p>Keratin 7 antibody
<p>The Keratin 7 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This antibody specifically targets the tyrosine residues on Keratin 7, which is a protein found in the epithelial cells of various tissues. By binding to these residues, the Keratin 7 antibody promotes cell growth and differentiation.</p>Degré de pureté :Min. 95%QPCT antibody
<p>QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA</p>Degré de pureté :Min. 95%5-(Azepan-2-ylidene)-2,2-dimethyl-1,3-dioxane-4,6-dione
CAS :Produit contrôlé<p>5-(Azepan-2-ylidene)-2,2-dimethyl-1,3-dioxane-4,6-dione is a synthetic chemical compound known for its role as a biochemical intermediate. This compound is synthesized through a controlled chemical process involving the reaction of relevant precursors under specific conditions, typically in a laboratory setting, making it an artificial construct rather than a naturally occurring substance.</p>Formule :C12H17NO4Degré de pureté :Min. 95%Masse moléculaire :239.27 g/molCCP2 antibody
<p>The CCP2 antibody is a highly specialized and potent intracellular antibody that targets a specific growth factor. This glycopeptide antibody is designed to neutralize the activity of the growth factor, preventing its binding to receptors and subsequent signaling pathways. The CCP2 antibody is a polyclonal antibody, meaning it is derived from multiple sources and recognizes multiple epitopes on the target molecule. It is produced using state-of-the-art techniques in Life Sciences research.</p>Degré de pureté :Min. 95%LGALS4 protein (Mouse) (His tag)
<p>Purified recombinant Mouse LGALS4 protein</p>Degré de pureté :Min. 95%MTO1 antibody
<p>MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV</p>Nebivolol
CAS :Produit contrôlé<p>β1-selective adrenergic receptor antagonist</p>Formule :C22H25F2NO4Degré de pureté :Min. 95%Masse moléculaire :405.44 g/molJD 5037
CAS :<p>JD 5037 is a monoclonal antibody that inhibits the binding of endocannabinoids to their receptors. This drug has been shown to be effective in animal models of obesity, diabetes, and cancer. JD 5037 binds to the CB2 receptor and antagonizes the effects of endocannabinoids by preventing them from binding. The high affinity of this drug for the CB2 receptor may be due to its tautomeric structure. This drug also appears to have potential as an anticancer agent due to its ability to bind and inhibit rapamycin complex-1 (raptor) and cb2 receptor.</p>Formule :C27H27C12N5O3SDegré de pureté :Min. 95%Masse moléculaire :645.73 g/molAdenovirus antibody
<p>Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.</p>ACSS2 antibody
<p>The ACSS2 antibody is a highly specific monoclonal antibody that has been developed for use in various applications within the Life Sciences field. This antibody is designed to target and bind to ACSS2, an enzyme involved in cellular metabolism. By specifically targeting ACSS2, this antibody can be used to study the role of this enzyme in various cellular processes.</p>B3GALNT2 antibody
<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL</p>Degré de pureté :Min. 95%Cyclin E1 antibody (Thr77)
<p>Human synthetic phosphopeptide (Thr77) region immunogen, Purified Rabbit polyclonal Cyclin E1 antibody (Thr77)</p>LITAF protein (His tag)
<p>Purified recombinant Human LITAF protein (His tag)</p>Degré de pureté :Min. 95%NPM antibody
<p>The NPM antibody is a highly reactive antibody that specifically targets Nucleophosmin (NPM), a multifunctional protein involved in various cellular processes. This antibody has been extensively used in research and diagnostics due to its ability to detect NPM in human serum and tissues.</p>DENND1B antibody
<p>DENND1B antibody was raised using the middle region of DENND1B corresponding to a region with amino acids PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY</p>Degré de pureté :Min. 95%SYNJ2BP protein (His tag)
<p>Purified recombinant SYNJ2BP protein (His tag)</p>Degré de pureté :Min. 95%SPNS2 antibody
<p>SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY</p>Lin28B antibody
<p>The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.</p>Clcn5 antibody
<p>Clcn5 antibody was raised in rabbit using the middle region of Clcn5 as the immunogen</p>Degré de pureté :Min. 95%CDCP1 antibody
<p>The CDCP1 antibody is a highly effective monoclonal antibody that specifically targets the CDCP1 protein. This antibody is designed to bind to and neutralize the activity of CDCP1, which plays a crucial role in various cellular processes. By blocking the function of CDCP1, this antibody inhibits the formation of CDCP1 dimers and prevents its activation.</p>GW-590735
CAS :<p>GW-590735 is a potent, non-peptide, orally bioavailable, small molecule activator of PPARs. It binds to the PPAR receptor and activates it by binding to the ligand binding domain, thereby increasing the expression of genes that are involved in lipid metabolism. GW-590735 has been shown to have anti-inflammatory effects in animal models of bowel disease, as well as beneficial effects on insulin sensitivity and energy homeostasis. GW-590735 has also been shown to activate PPARγ in cancer cells and reduce tumor growth. In addition, this drug has been shown to be effective for treatment of inflammatory diseases such as rheumatoid arthritis and Crohn's disease.</p>Degré de pureté :Min. 95%CSRP2 antibody
<p>CSRP2 antibody was raised in rabbit using the C terminal of CSRP2 as the immunogen</p>Degré de pureté :Min. 95%PSMA2 antibody
<p>PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV</p>FSH antibody
<p>FSH antibody was raised in mouse using human FSH from pituitary as the immunogen.</p>MIP3 alpha antibody
<p>MIP3 alpha antibody was raised in mouse using highly pure recombinant human MIP-3 alpha as the immunogen.</p>YIPF6 antibody
<p>YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL</p>Degré de pureté :Min. 95%GSTM2 antibody
<p>GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF</p>ABL1 antibody
<p>The ABL1 antibody is a monoclonal antibody that specifically targets the growth factor receptor ABL1. This biomolecule plays a crucial role in cell growth, division, and survival. The ABL1 antibody is designed to bind to the activated form of ABL1, neutralizing its function and preventing further downstream signaling.</p>TOP2B antibody
<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>Degré de pureté :Min. 95%
