Produits biochimiques et réactifs

<p>Rabbit polyclonal RPGRIP1L antibody</p>

<p>Purified recombinant Human DUSP13 protein (His tag)</p>

<p>Please enquire for more information about Alvimopan-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The CARM1 antibody is a powerful tool used in the field of Life Sciences. It specifically targets caveolin-1, a protein involved in cell signaling and membrane organization. This antibody can be utilized in various applications such as cDNA microarray analysis, where it helps researchers understand gene expression patterns. Additionally, the CARM1 antibody can be used as a diagnostic biomarker for certain diseases, making it an invaluable tool in the development of new medicines.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-4127</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>Cpa3 antibody was raised in rabbit using the N terminal of Cpa3 as the immunogen</p>

<p>RHBG antibody was raised using a synthetic peptide corresponding to a region with amino acids RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR</p>

<p>Region of IGF1 protein corresponding to amino acids GPETLCGAEL VDALQFVCGD RGFYFNKPTG YGSSSRRAPQ TGIVDECCFR SCDLRRLEMY CAPLKPAKSA.</p>

<p>Rabbit polyclonal CKMT antibody (HRP)</p>

<p>Purified recombinant KLK7 protein (His tag)</p>

<p>Rabbit polyclonal DDX39B antibody (HRP)</p>

<p>IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK</p>

<p>Rabbit polyclonal RuBisCO antibody (biotin)</p>

<p>Rabbit polyclonal RPL38 antibody</p>

<p>LSG1 antibody was raised in Rabbit using Human LSG1 as the immunogen</p>

<p>Rabbit polyclonal MCSF antibody (HRP)</p>

<p>Purified Polyclonal GAS41 antibody</p>

<p>NR3C1 antibody was raised in rabbit using the N terminal of NR3C1 as the immunogen</p>

<p>The SNX4 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is designed to target and bind to the SNX4 protein, which plays a crucial role in various cellular processes such as collagen synthesis and lysis. This antibody is widely used in immunoassays and research studies within the Life Sciences field.</p>

<p>WWP2 antibody was raised using the C terminal of WWP2 corresponding to a region with amino acids IDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQE</p>

<p>The RAB3A antibody is a polyclonal antibody that is cytotoxic and reactive. It can be used in various applications in the field of Life Sciences. This antibody specifically targets RAB3A, a protein involved in vesicle trafficking and neurotransmitter release. By binding to RAB3A, the antibody can modulate its function and potentially inhibit cellular processes that rely on this protein. Additionally, the RAB3A antibody has been shown to have antiviral properties and can be used as a tool to study viral infections. It is highly immunogenic and can elicit a strong antigen-antibody reaction. Researchers can use this antibody to detect the presence of RAB3A in samples and further investigate its role in cellular processes. With its versatility and wide range of applications, the RAB3A antibody is an essential tool for scientists studying protein-protein interactions, cellular signaling pathways, and immune responses.</p>

<p>CCDC25 antibody was raised in Rabbit using Human CCDC25 as the immunogen</p>

<p>ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN</p>

<p>BSG antibody is an inhibitor that targets the microparticles found in activated cells. It plays a crucial role in reducing microvessel density and inhibiting protein kinase activity. This antibody is known for its ability to neutralize autoantibodies, making it an effective agent for treating various diseases. BSG antibody also has the unique ability to interact with low-density lipoprotein receptors, aiding in the regulation of lipid metabolism. In the field of Life Sciences, this monoclonal antibody has shown promising results in studying bilayer membrane dynamics and protease activity. Moreover, BSG antibody has been found to be effective against atypical hemolytic disorders and can inhibit the growth factor signaling pathway. With its versatility and wide range of applications, BSG antibody is a valuable tool for researchers and clinicians alike.</p>

<p>Mouse monoclonal MICAL1 antibody</p>

<p>The CDK6 antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the structure and function of actin filaments in cells. This monoclonal antibody recognizes GFAP, a glycoprotein found in astrocytes and other glial cells. The CDK6 antibody can be used for various applications such as immunohistochemistry, immunofluorescence, and western blotting. It provides highly specific and sensitive detection of GFAP, allowing researchers to investigate the role of this protein in various cellular processes. With its high affinity and excellent performance, the CDK6 antibody is an essential tool for scientists studying glial cell biology and related fields.</p>

<p>Rabbit polyclonal RGS7 antibody</p>

<p>MRP9 antibody is a protein used in the field of Life Sciences and medicine. It is an antibody that specifically targets and inhibits the activity of MRP9, which is a biomarker associated with cellular immunotherapy. The antibody works by binding to MRP9 and preventing its function, thereby inhibiting the emission of interferon and other signaling molecules involved in immune responses. This inhibitor has been extensively studied and validated using various techniques such as cdna microarray analysis and reductase assays. MRP9 antibody can be used as a diagnostic biomarker to assess the presence or activity of MRP9 in cells or tissues, providing valuable information for disease diagnosis and treatment. Additionally, this antibody has shown promising results in caveolin-1-mediated cellular processes, making it a potential candidate for targeted therapies in various diseases.</p>

<p>Purified Rabbit polyclonal KCNQ3 antibody</p>

<p>Rabbit polyclonal Transferrin antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPNE1 antibody, catalog no. 70R-1407</p>

<p>TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA</p>

<p>Rabbit polyclonal GPR107 antibody</p>

<p>Mouse monoclonal IRF2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF766 antibody, catalog no. 70R-8882</p>

<p>Mouse monoclonal CST4 antibody</p>

<p>The GRIA1 antibody is a therapeutically valuable reagent that specifically targets the DNA double-strand of the GRIA1 gene. It is an extracellular antibody that can be used to test the efficacy of various compounds in inhibiting the activity of GRIA1. This antibody is particularly useful in pluripotent stem cell research, as it can help identify and isolate cells with high affinity for specific ligands. Additionally, the GRIA1 antibody can be utilized in immunohistochemical studies to visualize and analyze the expression of GRIA1 protein in different tissues and cell types. With its applications in Life Sciences and Monoclonal Antibodies, this antibody plays a crucial role in unraveling the interstitial functions of GRIA1 and advancing our understanding of pluripotent stem cells.</p>

<p>The ARF6 antibody is a cation that belongs to the group of polyclonal antibodies. It is derived from human serum albumin and is commonly used in life sciences research. This antibody specifically targets the epidermal growth factor (EGF) and has neutralizing properties against this growth factor. The ARF6 antibody can be used in various immunoassays to detect and quantify EGF-like molecules, such as chemokines, in biological samples. Its high affinity for human serum albumin ensures optimal binding and detection sensitivity. Researchers rely on the ARF6 antibody to accurately measure the levels of EGF and related molecules in their experiments.</p>

<p>Glutamate Dehydrogenase (GDH, L-GDH, GDH1, NAD(P)+ GDH1, mitochondrial Glutamate dehydrogenase 1, systemic name L-Glutamate:NAD(P)+ oxidoreductase, Cas No [9029-12-3], EC 1.4.1.4) is an enzyme that catalyzes the following reaction:   L-glutamate + H2O + NADP+ ⇌ α-ketoglutarate + NH4+ + NADPH   One unit of Glutamate Dehydrogenase will catalyze the oxidation of 1.0 μmol of NADH and the reductive amination of one micromole of alpha-ketoglutarate per minute at pH 7.95 and 37°C  in the presence of ADP. Bovine liver Glutamate Dehydrogenase is supplied in lyophilized form as a tan powder. It was lyophilized from sodium citrate and mannitol buffer, the activity is ≥15U/mg solid, specific activity ≥20U/mg protein. Store at -20°C on arrival.NADP+ is available here and NADPH is available here, depending on whether you require the reaction to proceed from left to right or from right to left, respectively.</p>

<p>Rabbit Polyclonal OR1N1 antibody</p>

<p>Slc12a5 antibody was raised in rabbit using the N terminal of Slc12a5 as the immunogen</p>

<p>Rabbit polyclonal NCK2 antibody</p>

<p>The MMP1 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets the matrix metalloproteinase 1 (MMP1), an enzyme involved in the breakdown of collagen. This antibody can be used to detect and quantify MMP1 levels in various samples, such as tissue lysates or cell culture supernatants.</p>

<p>Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.</p>

<p>Purified Polyclonal CDK5RAP3 antibody</p>

<p>GPR68 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal C20orf3 antibody</p>

<p>KIAA0040 antibody was raised in rabbit using the middle region of KIAA0040 as the immunogen</p>

<p>Purified Native Bordetella pertussis toxin protein</p>