Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H2AFZ antibody
<p>H2AFZ antibody was raised in rabbit using the N terminal of H2AFZ as the immunogen</p>CD99L2 antibody
<p>CD99L2 antibody was raised in rabbit using the middle region of CD99L2 as the immunogen</p>TOM1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TOM1 antibody, catalog no. 70R-4061</p>Degré de pureté :Min. 95%GLUD2 antibody
<p>GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF</p>IRS1 antibody
<p>The IRS1 antibody is a monoclonal antibody that targets the insulin receptor substrate 1 (IRS1) protein. This protein plays a crucial role in mediating the effects of various growth factors and cytokines, such as interleukin-6. The IRS1 antibody specifically recognizes and binds to the IRS1 protein, inhibiting its signaling pathway and preventing downstream cellular responses.</p>Degré de pureté :Min. 95%CROT antibody
<p>CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK</p>PWP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PWP2 antibody, catalog no. 70R-1968</p>Degré de pureté :Min. 95%P38 MAPK antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high activity on human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Fxn antibody
<p>Fxn antibody was raised in rabbit using the middle region of Fxn as the immunogen</p>Degré de pureté :Min. 95%Sepn1 antibody
<p>Sepn1 antibody was raised in rabbit using the C terminal of Sepn1 as the immunogen</p>Degré de pureté :Min. 95%TM4SF20 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TM4SF20 antibody, catalog no. 70R-6760</p>Degré de pureté :Min. 95%SLC22A1 antibody
<p>SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD</p>PDE8A antibody
<p>PDE8A antibody was raised in rabbit using the C terminal of PDE8A as the immunogen</p>Degré de pureté :Min. 95%MCM8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-1607</p>Degré de pureté :Min. 95%TFPI2 antibody
<p>TFPI2 antibody was raised in rabbit using the N terminal of TFPI2 as the immunogen</p>Degré de pureté :Min. 95%WDR63 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR63 antibody, catalog no. 70R-4155</p>Degré de pureté :Min. 95%Rabbit anti Rat IgG (HRP)
<p>Rabbit anti-rat IgG (HRP) was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.</p>Degré de pureté :Min. 95%ZNF91 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF91 antibody, catalog no. 70R-8707</p>Degré de pureté :Min. 95%TBC1D14 antibody
<p>TBC1D14 antibody was raised using the N terminal of TBC1D14 corresponding to a region with amino acids MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL</p>NF kappaB p65 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>FRK Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FRK antibody, catalog no. 70R-5665</p>Degré de pureté :Min. 95%MTAP antibody
<p>The MTAP antibody is a highly specialized product in the field of Life Sciences. It is a nuclear monoclonal antibody that has been developed for various applications, including antinociceptive research. This antibody specifically targets the retinoid-binding protein MTAP, which is found in high levels in certain tissues and cells.</p>DRGX antibody
<p>DRGX antibody was raised in rabbit using the middle region of DRGX as the immunogen</p>Degré de pureté :Min. 95%CDC5L Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDC5L antibody, catalog no. 70R-4924</p>Degré de pureté :Min. 95%FAM156A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM156A antibody, catalog no. 70R-4820</p>Degré de pureté :Min. 95%ZFYVE1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFYVE1 antibody, catalog no. 70R-9007</p>Degré de pureté :Min. 95%DDC antibody
<p>DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE</p>β 2 Microglobulin protein
<p>The beta 2 Microglobulin protein is a versatile molecule with a wide range of characteristics and applications. It has been shown to have toxic effects on human serum, affecting various biological processes. Additionally, it plays a role in the production of colony-stimulating factors, which are essential for the growth and differentiation of cells.</p>Degré de pureté :Min. 95%ALDH3B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH3B1 antibody, catalog no. 70R-2992</p>Degré de pureté :Min. 95%SDCBP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDCBP antibody, catalog no. 70R-1718</p>Degré de pureté :Min. 95%CDC2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDC2 antibody, catalog no. 70R-5615</p>Degré de pureté :Min. 95%PIK3R1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIK3R1 antibody, catalog no. 70R-7897</p>Degré de pureté :Min. 95%C19orf2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf2 antibody, catalog no. 70R-8987</p>Degré de pureté :Min. 95%IFNAR2 antibody
<p>IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.</p>Bradykinin Receptor B2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BDKRB2 antibody, catalog no. 70R-1662</p>Degré de pureté :Min. 95%Chst11 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Chst11 antibody, catalog no. 70R-8685</p>Degré de pureté :Min. 95%GPT2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPT2 antibody, catalog no. 70R-2968</p>Degré de pureté :Min. 95%ATP6AP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6AP1 antibody, catalog no. 70R-4520</p>Degré de pureté :Min. 95%
