Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
L1CAM antibody
<p>The L1CAM antibody is a highly activated monoclonal antibody that targets CD33, a protein found on the surface of adipose cells. This antibody is reactive and has been extensively studied in the field of Life Sciences. It has been shown to have neutralizing properties, inhibiting the growth factor signaling pathways associated with adipose tissue development. Additionally, this antibody has hepatoprotective effects, protecting liver cells from damage caused by lipofuscin accumulation. The L1CAM antibody can also activate phosphatase and 3-kinase enzymes, which play crucial roles in cellular signaling pathways. With its high specificity and potency, this monoclonal antibody is an excellent tool for research and therapeutic applications in various fields.</p>ROM1 antibody
<p>ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT</p>Degré de pureté :Min. 95%KCNJ12 antibody
<p>KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR</p>Degré de pureté :Min. 95%RGS19 antibody
<p>RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW</p>Degré de pureté :Min. 95%CEA antibody
<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>SEC63 antibody
<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>Degré de pureté :Min. 95%CRYAB antibody
<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>TST antibody
<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>Synaptotagmin antibody
<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>Degré de pureté :Min. 95%SIGLEC7 antibody
<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL</p>Degré de pureté :Min. 95%CYP2A6 antibody
<p>The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.</p>Degré de pureté :Min. 95%E2F2 antibody
<p>E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)</p>CD3E antibody
<p>The CD3E antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and neutralizes alpha-fetoprotein, a protein complex found in human serum. The CD3E antibody has been extensively studied for its binding properties to steroid binding proteins, particularly those involved in nuclear receptor signaling pathways. This antibody is known for its high affinity and specificity, making it an ideal tool for research and diagnostic applications. Whether you are studying protein-protein interactions or investigating the role of specific molecules in cellular processes, the CD3E antibody is an essential tool in your arsenal. Trust this monoclonal antibody to deliver accurate and reliable results for all your scientific endeavors.</p>Rbm3 antibody
<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>Degré de pureté :Min. 95%Chlorpromazine antibody
<p>The Chlorpromazine antibody is a highly specialized monoclonal antibody that specifically targets and binds to chlorpromazine, a metal-binding protein. This multispecific antibody is designed to recognize and bind to specific lysine and acid residues on chlorpromazine molecules. The Chlorpromazine antibody can be used in various applications, such as immunohistochemistry, flow cytometry, and Western blotting.</p>Degré de pureté :Min. 95%DLAT antibody
<p>The DLAT antibody is a highly specialized monoclonal antibody that has been developed for use in various life sciences applications. It is designed to specifically target and bind to DLAT, also known as dihydrolipoamide S-acetyltransferase. This protein plays a crucial role in the function of the pyruvate dehydrogenase complex, which is involved in energy metabolism.</p>PRKX antibody
<p>PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD</p>T and B cell activation antigen antibody (biotin)
<p>Rat monoclonal T and B cell activation antigen antibody (biotin)</p>TYRO3 antibody
<p>The TYRO3 antibody is a monoclonal antibody that is widely used in the field of life sciences. It has neutralizing properties and can effectively bind to specific antigens, thereby inhibiting their activity. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>LST-3TM12 antibody
<p>LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH</p>Degré de pureté :Min. 95%FAM19A3 antibody
<p>FAM19A3 antibody was raised using the middle region of FAM19A3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV</p>Degré de pureté :Min. 95%NANP antibody
<p>The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein (CSP) found on the surface of Plasmodium falciparum, the parasite responsible for malaria. This antibody has been shown to inhibit the invasion of red blood cells by the parasite and disrupt its life cycle. It binds to CSP and prevents it from interacting with host cell receptors, thereby preventing infection. The NANP antibody also has potential therapeutic applications in the treatment of other diseases, as it has been found to bind to other proteins such as collagen and tyrosine kinase-like growth factor-2. Its unique properties make it a valuable tool in life sciences research and drug development.</p>CHI3L2 protein
<p>The CHI3L2 protein is a growth factor inhibitor that is commonly used in the field of Life Sciences. It belongs to the class of Conjugated Proteins and can be targeted using monoclonal antibodies. CHI3L2 has been shown to inhibit the activity of oncostatin, sorafenib, and interferon, making it an effective antiangiogenic agent. Additionally, this protein has neutralizing properties and can prevent hemolysis. Its ability to inhibit endothelial growth makes it a valuable tool in research and therapeutic applications. When purchasing CHI3L2 protein, make sure to check for the presence of any excipients that may affect its stability or activity.</p>Degré de pureté :Min. 95%B3GALT1 antibody
<p>B3GALT1 antibody was raised using the N terminal of B3GALT1 corresponding to a region with amino acids MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF</p>Degré de pureté :Min. 95%GALNT5 antibody
<p>GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE</p>Degré de pureté :Min. 95%SERPINA1 antibody
<p>The SERPINA1 antibody is a monoclonal antibody used in the field of life sciences. It specifically targets alpha-fetoprotein, a family kinase inhibitor that plays a crucial role in various cellular processes. The antibody has been extensively studied and shown to effectively neutralize the growth factor activity of alpha-fetoprotein.</p>RHOBTB1 antibody
<p>RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN</p>Degré de pureté :Min. 95%Troponin I antibody (Skeletal Muscle)
<p>Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.</p>SIGLEC6 antibody
<p>SIGLEC6 antibody was raised using the C terminal of SIGLEC6 corresponding to a region with amino acids IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK</p>Degré de pureté :Min. 95%KLHL1 antibody
<p>KLHL1 antibody was raised in Mouse using a purified recombinant fragment of human KLHL1 expressed in E. coli as the immunogen.</p>CD90 antibody
<p>The CD90 antibody is a monoclonal antibody that targets the CD90 antigen, also known as Thy-1. It is widely used in life sciences research to study various cellular processes and functions. The CD90 antibody specifically binds to actin filaments and has been shown to inhibit flavobacterium growth. Additionally, it can be used in conjunction with other antibodies to detect and quantify the expression of GM-CSF (colony-stimulating factor) binding proteins. This versatile antibody is commonly used in immunohistochemistry, flow cytometry, and western blotting applications. Its high specificity and affinity make it an essential tool for researchers studying cell signaling pathways, immune responses, and tissue regeneration.</p>Fibrinogen antibody
<p>The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.</p>
