Produits biochimiques et réactifs

<p>The CD146 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to CD146, a protein expressed on the surface of various cell types. This antibody has been extensively studied and proven to be effective in numerous applications.</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>Mouse monoclonal MKI67 antibody</p>

<p>SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL</p>

<p>STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIK</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has proven its high activity in human erythrocytes using a patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>AFP antibody was raised against Human Alfafetoprotein (AFP).</p>

<p>ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen</p>

<p>SLCO1A2 antibody was raised in rabbit using the middle region of SLCO1A2 as the immunogen</p>

<p>Rabbit polyclonal SNX19 antibody</p>

<p>Rabbit polyclonal WFDC2 antibody (HRP)</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK</p>

<p>CD1d antibody is a monoclonal antibody that targets CD1d, a protein involved in immune responses. It has been shown to have potential therapeutic applications in various fields of life sciences. CD1d antibody can be used for research purposes, such as studying the role of CD1d in immune system function and identifying potential therapeutic targets for diseases like choroidal neovascularization and cryptosporidium infection. Additionally, this antibody can be utilized in nuclear assays to detect and analyze the expression of CD1d in different cell types. The use of CD1d antibody provides researchers with a valuable tool to further understand the complex mechanisms of immune response and develop innovative treatments.</p>

<p>Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Rabbit polyclonal RUFY2 antibody</p>

<p>Purified recombinant POP4 protein (His tag)</p>

<p>ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>SIRT1 antibody was raised in Mouse using a purified recombinant fragment of human SIRT1 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Mouse brain antibody (FITC) was raised in rabbit using brain tissue from Balb/c mice as the immunogen.</p>

<p>The HDAC1 antibody is a highly specialized antibody that is used for various research purposes. It is commonly used in studies involving human serum, electrode, casein, and inhibitory factors. This antibody specifically targets the HDAC1 protein, which is an important enzyme involved in gene regulation. The HDAC1 antibody can be used in both monoclonal and polyclonal forms, depending on the specific research needs. It is a glycoprotein that binds to the HDAC1 protein with high affinity, allowing for accurate detection and analysis. Researchers can use this antibody to study various aspects of gene expression, including messenger RNA levels and oncostatin signaling pathways. The HDAC1 antibody is produced using advanced techniques that ensure high specificity and sensitivity. It contains primary amino acids and cysteine disulfide bonds that contribute to its stability and effectiveness. Whether you are studying gene regulation or conducting experiments in molecular biology, the HDAC1 antibody is an essential tool for your research endeavors.</p>

<p>The Myogenin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the alpha-fetoprotein, which is a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be highly effective in binding to the alpha-fetoprotein, making it an essential tool for researchers studying its function and potential therapeutic applications.</p>

<p>Purified native Mouse Haptoglobin protein</p>

<p>Rabbit polyclonal HXA5 antibody</p>

<p>The beta Catenin antibody is a growth factor that belongs to the class of antibodies. It acts as an inhibitor, blocking the action of other antibodies and chemokines. In the field of Life Sciences, this monoclonal antibody is widely used as a test compound for various experiments. It specifically targets beta catenin, a nuclear protein involved in cell signaling and adhesion. This antibody has a neutralizing effect on beta catenin, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, it has been shown to inhibit endothelial growth and interfere with interferon-gamma (IFN-gamma) signaling. The beta Catenin antibody is an essential tool for researchers in the field of Life Sciences looking to study and manipulate cellular processes involving beta catenin.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>Mouse monoclonal IFT57 antibody</p>

<p>Purified Polyclonal CRHR1 antibody</p>

<p>GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fxn antibody, catalog no. 70R-8779</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR1D antibody, catalog no. 70R-2039</p>

<p>Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal RANBP9 antibody</p>

<p>ZNF491 antibody was raised in rabbit using the N terminal of ZNF491 as the immunogen</p>

<p>Rabbit polyclonal SENP8 antibody</p>

<p>Mouse monoclonal AMPKa1 antibody (N-terminus)</p>

<p>Purified recombinant Human CD83 protein (His tag)</p>

<p>Lymphotoxin alpha antibody is a highly specialized medicament used in Life Sciences research. It is an inhibitor that targets adeno-associated virus and plays a crucial role in pluripotent stem cells. This antibody has been extensively used in assays to study the effects of test compounds on interleukin production. Lymphotoxin alpha antibody possesses high affinity for its ligands and has been employed in the isolation of autoantibodies and extracellular markers. Its unique properties make it an indispensable tool for researchers studying various biological processes, including those related to the retina.</p>

<p>Rabbit polyclonal UMOD antibody</p>

<p>COPS7A antibody was raised using a synthetic peptide corresponding to a region with amino acids NLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGL</p>

<p>The SOX5 antibody is a monoclonal antibody that targets the catechol-O-methyltransferase (COMT) enzyme. It is widely used in Life Sciences research as a biomolecule for various applications. This antibody specifically recognizes and binds to the activated form of COMT, inhibiting its enzymatic activity. By neutralizing COMT, the SOX5 antibody modulates dopamine levels, which plays a crucial role in several physiological processes.</p>

<p>ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM</p>

<p>Mouse monoclonal DCXR antibody</p>

<p>Purified Polyclonal MED22 antibody</p>

<p>GABA A Receptor alpha-1 antibody was raised in mouse using purified GABA/benzodiazepine receptor from bovine cortex as the immunogen.</p>

<p>The Keratin 18 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic and neutralizing properties. It is commonly used in Life Sciences research to study the role of keratin 18 in various cellular processes. This antibody specifically targets keratin 18, a type of intermediate filament protein found in epithelial cells.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It effectively treats tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>