Produits biochimiques et réactifs

<p>Rabbit polyclonal SDP3 antibody (FITC)</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>AVPV1a antibody was raised in rabbit using 19aa peptide of rat AVP-VIa receptor. as the immunogen.</p>

<p>1-328 amino acids: MGSSHHHHHH SSGLVPRGSH MSMLAERRRK QKWAVDPQNT AWSNDDSKFG QRMLEKMGWS KGKGLGAQEH GATDHIKVQV KNNHLGLGAT INNEDNWIAH QDDFNQLLAE LNTCHGQETT DSSDKKEKKS FSLEEKSKIS KNRVHYMKFT KGKDLSSRSK TDLDCIFGKR QSKKTPEGDA SPSTPEENET TTTSAFTIQE YFAKRMAALK NKPQVPVPGS DISETQVERK RGKKINKEAT GKDVESYLQP KAKRHTEGKP ERAEAQERVA KKKSAPAEEQ LRGPCWDQSS KASAQDAGDH VQPPEGRDFT LKPKKRRGKK KLQKPVEIAE DATLEETLVK KKKKKDSK</p>

<p>The BIRC3 antibody is a growth factor that belongs to the family of antibodies. It has been shown to be effective in human serum, specifically targeting alpha-fetoprotein and anti-mesothelin. This antibody can also bind to nuclear proteins and activate specific pathways related to cell growth and survival. The BIRC3 antibody is a monoclonal antibody, meaning it is highly specific and targeted. It has been used in various life sciences applications, including the study of fibrinogen, chemokines, and the neutralization of CD33 antibodies. Its versatility and effectiveness make it a valuable tool for researchers in the field.</p>

<p>Rabbit polyclonal TUBGCP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STK16 antibody, catalog no. 70R-3483</p>

<p>The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.</p>

<p>The PDLIM2 antibody is a powerful tool in the field of life sciences. This monoclonal antibody targets PDLIM2, a protein that plays a crucial role in various cellular processes. It has been observed that low levels of PDLIM2 are associated with dopamine dysregulation and may contribute to certain neurological disorders.</p>

<p>Rabbit Polyclonal TISB antibody</p>

<p>Rabbit polyclonal SLC17A1 antibody</p>

<p>The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.</p>

<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>

<p>Rabbit polyclonal Transaldolase antibody (FITC)</p>

<p>TRIM56 antibody was raised in rabbit using the middle region of TRIM56 as the immunogen</p>

<p>Mouse monoclonal ITM2B antibody</p>

<p>CDK5RAP1 antibody was raised using the N terminal of CDK5RAP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE</p>

<p>The Doublecortin antibody is a monoclonal antibody that targets the protein doublecortin, which is involved in the development of nerve cells. This antibody has been widely used in neuroscience research to study neurogenesis and neuronal migration. It has also been used to detect doublecortin expression in various tissues, including brain tissue and tumor samples. The Doublecortin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific experiments. With its high specificity and sensitivity, this antibody is an essential tool for investigating the role of doublecortin in various biological processes.</p>

<p>The VDAC2 antibody is a highly specific monoclonal antibody that targets the voltage-dependent anion channel 2 (VDAC2). This antibody is widely used in the field of life sciences for various applications. It has been shown to be effective in detecting and quantifying VDAC2 protein levels in different samples, including cell lysates and tissues.</p>

<p>Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI</p>

<p>The CENPH antibody is an acidic monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the role of GFAP in various cellular processes. This antibody can be used for immunohistochemistry, immunofluorescence, and western blotting applications. It has high specificity and sensitivity, making it a valuable tool for studying the expression and localization of GFAP in different tissues and cell types. The CENPH antibody can also be used in studies related to insulin signaling, transferrin uptake, glucose-6-phosphate metabolism, collagen synthesis, and antiphospholipid antibodies. With its reliable performance and wide range of applications, this antibody is a must-have for researchers in the field of life sciences.</p>

<p>NKp46 antibody was raised in mouse using recombinant human Nkp46 (22-255aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal SLC1A1 antibody</p>

<p>Rabbit polyclonal OR10J6 antibody</p>

<p>Chicken Red Blood Cells are widely used in the field of Life Sciences for various applications. They are commonly utilized in veterinary settings as an immune modulator and antimicrobial peptide. Chicken Red Blood Cells also serve as a diagnostic reagent, particularly in the detection of antibodies through techniques such as monoclonal antibody production and antibody-secreting cell assays. To obtain Chicken Red Blood Cells, sodium dodecyl sulfate or nonionic detergents can be used to induce cell lysis. Additionally, hydrochloric acid can be employed to further facilitate the lysis process. The resulting lysate can then be utilized for various downstream applications, including polymerase chain reactions (PCR) and other molecular biology techniques. Overall, Chicken Red Blood Cells offer a valuable resource for researchers and veterinarians alike, providing essential tools for immunological studies and diagnostic purposes. Their versatility and reliability make them an indispensable component in many scientific endeavors.</p>

<p>Cytokeratin 14 antibody was raised in guinea pig using recombinant human cytokeratin 14 as the immunogen.</p>

<p>Purified Polyclonal Kappa actin antibody</p>

<p>Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV</p>

<p>Mouse monoclonal anti human PDCL3 antibody</p>

<p>The IKB alpha antibody is a receptor-binding monoclonal antibody that targets the IKB alpha protein. It is commonly used in research and diagnostic applications to detect and quantify the levels of IKB alpha in various samples. The IKB alpha protein plays a crucial role in regulating the activity of NF-kappaB, a transcription factor involved in immune response and inflammation. By specifically binding to IKB alpha, this antibody can help researchers study the mechanisms underlying NF-kappaB activation and its downstream effects. Additionally, the IKB alpha antibody can be used as a tool for therapeutic purposes, such as blocking the interaction between IKB alpha and other binding proteins or autoantibodies. Its versatility makes it an essential tool for studying various biological processes and developing potential inhibitors for diseases associated with NF-kappaB dysregulation, such as autoimmune disorders or certain types of cancer.</p>

<p>Rat monoclonal Galectin 3 antibody (PE)</p>

<p>SCGB2A2 antibody was raised in Mouse using a purified recombinant fragment of human SCGB2A2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PKC mu antibody</p>

<p>ZNF136 antibody was raised in mouse using recombinant Zinc Finger Protein 136</p>

<p>TMB Substrate is a versatile product widely used in Life Sciences research. It is commonly utilized in various applications such as immunoassays and ELISA (enzyme-linked immunosorbent assay). TMB Substrate contains cefotiam, streptavidin, and monoclonal antibodies that enable accurate detection of specific targets. The substrate is activated by sodium carbonate and can be easily visualized with the addition of anhydrous sodium and hydrochloric acid. TMB Substrate also includes diluents, blockers, and assay reagents to optimize performance. It is compatible with human serum samples and can be used to measure chemokine levels or assess the activity of antibiotics like ceftriaxone and cefmetazole. Trust TMB Substrate for reliable and precise results in your scientific experiments.</p>

<p>TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTSHTEGRAWPLPSSSRPQRSPKRMGVHHLHRKDSLTQAQEQGNLLN</p>

<p>Purified Rabbit polyclonal ELOVL1 antibody</p>

<p>OGT antibody was raised using a synthetic peptide corresponding to a region with amino acids ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE</p>

<p>The HNF4 alpha antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the HNF4 alpha protein, which plays a crucial role in regulating gene expression and cellular functions. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The COXIV antibody is a polyclonal antibody that targets the COXIV protein, a subunit of cytochrome c oxidase. It is commonly used in Life Sciences research to study cellular respiration and mitochondrial function. This antibody has been shown to have neutralizing activity against the COXIV protein, inhibiting its function and preventing the production of ATP. The COXIV antibody can be used in various techniques such as Western blotting, immunohistochemistry, and ELISA. It is a valuable tool for researchers studying oxidative phosphorylation and its role in diseases such as cancer, neurodegenerative disorders, and cardiovascular diseases.</p>

<p>SLC18A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>DCP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK</p>

<p>ZNF44 antibody was raised in mouse using recombinant Human Zinc Finger Protein 44 (Znf44)</p>

<p>PLA2G4B antibody was raised in rabbit using the N terminal of PLA2G4B as the immunogen</p>

<p>Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL</p>

<p>Rabbit polyclonal Catenin beta antibody (Tyr654)</p>