Produits biochimiques et réactifs

<p>Purified recombinant Human PITPNA protein</p>

<p>PLEKHA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV</p>

<p>Recombinant Human DCTN6 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB4 antibody, catalog no. 70R-4031</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4X1 antibody, catalog no. 70R-7249</p>

<p>TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP</p>

<p>Corticosteroid Binding Globulin (CBG) protein is a growth factor that plays a crucial role in regulating the body's response to stress and inflammation. It binds to corticosteroids, such as cortisol, in the blood, controlling their availability and activity. CBG also interacts with reactive oxygen species and antibodies, contributing to immune system function.</p>

<p>CD40 ligand protein is an activated protein that plays a crucial role in immune response and cell signaling. It is commonly used in research and diagnostic applications. The CD40 ligand protein has an antigen binding domain that interacts with the CD40 receptor on B cells, leading to their activation and differentiation. This protein can be used as a tool in various assays, such as chemiluminescent immunoassays or DNA vaccines. It can also be conjugated to other molecules, such as monoclonal antibodies or chemokines, for specific applications. The CD40 ligand protein is stable and can be easily immobilized on surfaces like carbon electrodes for electrode-based assays. Its structure consists of amino acid residues that are methylated, providing stability and enhancing its functionality. Researchers in the life sciences field often rely on this protein to investigate immune responses and develop new therapeutic strategies.</p>

<p>Rabbit polyclonal MRPL48 antibody</p>

<p>DGAT2L7 antibody was raised in rabbit using the C terminal of DGAT2L7 as the immunogen</p>

<p>Purified recombinant Angiogenin protein (His tag)</p>

<p>The Myc antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the c-myc protein, which plays a crucial role in cell growth and proliferation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.</p>

<p>NR5A2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit Polyclonal OR8I2 antibody</p>

<p>LUF7244 is a pharmaceutical agent, which is a synthetic compound derived from rational drug design. Its primary source is laboratory synthesis utilizing advanced organic chemistry techniques. The mode of action of LUF7244 involves selective antagonism of specific receptor subtypes, allowing for precise modulation of receptor activity. This antagonistic behavior is achieved through competitive binding at the receptor site, inhibiting the natural ligand interaction and subsequent signaling pathways.</p>

<p>KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH</p>

<p>Keratin K10 antibody was raised in Guinea Pig using synthetic peptide of human keratin K10 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal Dab1 antibody</p>

<p>Purified recombinant p15 Treponema Pallidum protein</p>

<p>Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids KESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNSIMIVLVMLLNI</p>

<p>Tropomyosin protein is a lipoprotein lipase that plays a crucial role in various cellular processes. It is involved in the regulation of lipase activity and has been found to be associated with the development of certain diseases, such as breast cancer. Tropomyosin protein has been studied extensively in the field of Life Sciences and has shown potential as a target for therapeutic interventions. Monoclonal antibodies against tropomyosin protein have been developed and have demonstrated neutralizing effects on its activity. These antibodies can be used in research and diagnostic applications to study antigen-antibody reactions and to detect tropomyosin protein levels in biological samples. The availability of native proteins and antigens allows for accurate and reliable measurements, contributing to advancements in the understanding of this important biomolecule.</p>

<p>The PRDX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to PRDX1, a protein involved in various cellular processes. This antibody has been shown to inhibit collagen production and the activity of certain enzymes, making it a potential therapeutic option for conditions related to collagen disorders and enzyme dysregulation. Additionally, the PRDX1 antibody has cytotoxic properties, meaning it can induce cell death in specific cell types. It can also be used as a tool in laboratory experiments to detect and quantify PRDX1 levels in samples. With its ability to target PRDX1 and modulate its function, this antibody holds promise for developing novel treatments and understanding the role of PRDX1 in different biological pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APEH antibody, catalog no. 70R-2582</p>

<p>Purified recombinant Human RAB21 protein</p>

<p>Purified recombinant Human PSMB9 protein</p>

<p>Purified Polyclonal OCRL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX19 antibody, catalog no. 70R-3408</p>

<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF</p>

<p>Affinity purified Rabbit polyclonal GPR137B antibody</p>

<p>Purified Polyclonal TBX22 antibody</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Mouse monoclonal Tn antigen antibody (Prediluted for IHC)</p>

<p>ITGA3 antibody was raised in Rabbit using Human ITGA3 as the immunogen</p>

<p>Rabbit polyclonal CDH9 antibody</p>

<p>Pig IgM is a chimeric protein that belongs to the family of immunoglobulins. It is a monoclonal antibody that has been purified and is used in Life Sciences research. Pig IgM specifically targets amyloid plaques, which are abnormal protein deposits found in various diseases, such as Alzheimer's disease. This antibody-drug complex can be used for the detection and quantification of amyloid plaques in brain tissue samples. Pig IgM has high affinity and specificity for the target antigen, making it an ideal tool for researchers studying amyloid-related disorders. Additionally, this antibody can be used in immunoassays to measure the levels of brain natriuretic peptide (BNP), a hormone involved in regulating blood pressure and fluid balance, in human serum samples. The use of Pig IgM in these assays ensures accurate and reliable results due to its high sensitivity and low background interference.</p>

<p>RIOK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLA</p>

<p>Mouse monoclonal DNAJB2 antibody</p>

<p>JUP antibody was raised in Rabbit using Human JUP as the immunogen</p>

<p>Purified recombinant TDG protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. With its high frequency of human activity, it has been extensively studied using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>RSV antibody was raised in rabbit using residues 201-211 [KQLLPIVNKQSC] of the 63 kDa RSV F protein as the immunogen.</p>

<p>Rabbit polyclonal ATXN1 antibody (Ser776)</p>

<p>C8ORF34 antibody was raised using the N terminal Of C8Orf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK</p>

<p>Mouse monoclonal HA1C antibody</p>

<p>CIB4 antibody was raised in Rabbit using Human CIB4 as the immunogen</p>

<p>CTDSP2 antibody was raised in Rabbit using Human CTDSP2 as the immunogen</p>

<p>MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV</p>

<p>Rabbit polyclonal Goat Serum Albumin antibody (HRP)</p>

<p>DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF</p>

<p>Rabbit Polyclonal p62Dok antibody (Tyr362)</p>