Produits biochimiques et réactifs

<p>Rabbit polyclonal LN28A antibody</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 18-28 of cTnI as the immunogen.</p>

<p>The ALK antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to ALK (anaplastic lymphoma kinase), a protein that plays a crucial role in cell growth and division. By binding to ALK, this antibody can help researchers study its function and investigate its involvement in various diseases.</p>

<p>The CLPP antibody is a highly specialized biomolecule that belongs to the class of monoclonal antibodies. It specifically targets chemokine binding proteins and has been widely used in life sciences research. This monoclonal antibody has a high affinity for its target and can be used for various applications, including immunoassays, protein detection, and cell signaling studies. The CLPP antibody has been shown to have cytotoxic effects on activated cells and can be used as a tool for targeted therapy. It can also be immobilized on electrodes or collagen matrices for use in biosensors or tissue engineering applications. With its exceptional specificity and versatility, the CLPP antibody is an invaluable tool in the field of molecular biology and biomedical research.</p>

<p>MLF2 antibody was raised in Rabbit using Human MLF2 as the immunogen</p>

<p>The eNOS antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied and proven to have significant cation binding properties. Through molecular docking, it has shown a strong affinity for epidermal growth factor (EGF), making it an essential tool for researchers studying EGF-related pathways.</p>

<p>Recombinant Human LAP3 protein (His tag)</p>

<p>GPR44 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SSE15206 is a chemical compound commonly referred to as an intermediate in organic synthesis. It is derived from complex chemical precursors through an extensive series of reactions involving catalysts and controlled conditions. This compound serves a pivotal role in the synthetic pathway by enabling the construction of more intricate molecules.</p>

<p>SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.</p>

<p>The F3 antibody is a potent cytotoxic and inhibitory factor used in Life Sciences. It targets various proteins and molecules such as tyrosinase, insulin, collagen, and fibronectin. This antibody has been extensively studied for its ability to neutralize autoantibodies and anti-ACTH antibodies. The F3 antibody is highly specific and can be used in a wide range of applications including research, diagnostics, and therapeutics. Its unique properties make it an essential tool for studying protein-protein interactions, cell signaling pathways, and immune responses. With its high affinity and specificity, the F3 antibody offers researchers unparalleled accuracy and reliability in their experiments.</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>The PYCR2 protein is a growth factor that plays a crucial role in neutralizing interferon. It is widely used in the field of Life Sciences for various applications. PYCR2 protein has been extensively studied and its binding proteins are well characterized. It is commonly used as a target for antibody-drug conjugates, monoclonal antibodies, and other therapeutic agents. PYCR2 protein is often purified from liver microsomes and can be used in research studies to investigate its interaction with other molecules such as globulins, chemokines, and anti-CD20 antibodies. This highly purified protein is free from any excipients and has a high refractive index, making it ideal for use in experiments requiring precise measurements.</p>

<p>Rat monoclonal Flk 1 antibody (allophycocyanin)</p>

<p>TRF3 antibody was raised in rabbit using the N terminal of TRF3 as the immunogen</p>

<p>The NRF2 antibody is a highly effective tool in the field of immunology and molecular biology. This antibody belongs to the class of polyclonal antibodies, which are produced by multiple B cell clones and have the ability to recognize different epitopes on the target protein. The NRF2 antibody specifically targets the nuclear factor erythroid 2-related factor 2 (NRF2), a transcription factor that plays a crucial role in cellular defense against oxidative stress.</p>

<p>Complement C3 protein is a test compound that plays a crucial role in the immune system. It is involved in various processes such as inflammation, opsonization, and immune complex clearance. Complement C3 protein interacts with IFN-gamma and is found to have intraocular effects. This protein is commonly used in research and diagnostic applications in the field of Life Sciences. It has been shown to exhibit neutralizing properties against autoantibodies and can be used for studying interferon and chemokine signaling pathways. Additionally, complement C3 protein has been implicated in endothelial growth factor regulation, making it an important target for therapeutic interventions related to angiogenesis. Its high viscosity allows for easy handling during experiments.</p>

<p>The CYP19 antibody is a highly specialized antibody that targets the aromatase enzyme, also known as cytochrome P450 19A1. This enzyme plays a crucial role in the synthesis of estrogen, making it an important target in hormone-related diseases and conditions. The CYP19 antibody specifically binds to the aromatase enzyme, inhibiting its activity and preventing the conversion of androgens into estrogens. This can have significant therapeutic implications in the treatment of hormone-dependent cancers such as breast cancer. Additionally, the CYP19 antibody has been used in research settings to study the regulation of estrogen synthesis and its impact on various physiological processes. With its high specificity and affinity for the aromatase enzyme, the CYP19 antibody is a valuable tool for both clinical and scientific applications in the field of endocrinology and oncology.</p>

<p>LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL31 antibody, catalog no. 70R-6296</p>

<p>FOXA1 antibody is a monoclonal antibody that specifically targets β-catenin, a protein involved in various cellular processes. This antibody acts as a family kinase inhibitor, blocking the activity of kinases that regulate β-catenin signaling. It is widely used in life sciences research to study the role of β-catenin in development, cancer, and other diseases.</p>

<p>ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA</p>

<p>Beta galactosidase antibody was raised in rabbit using beta galactosidase (E. Coli) as the immunogen.</p>

<p>BTF3L1 antibody was raised in rabbit using the n terminal of BTF3L1 as the immunogen</p>

<p>Purified Rabbit polyclonal LETMD1 antibody</p>

<p>PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL</p>

<p>NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Studies have shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>KIF5A antibody was raised using the middle region of KIF5A corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH</p>

<p>FABP3 protein is a growth factor that plays a crucial role in various biological processes. It can be activated by specific antibodies present in human serum, leading to the promotion of anti-angiogenesis activities. FABP3 is a glycoprotein that binds to fatty acids and facilitates their transport within cells. This protein can be detected using streptavidin-coated electrodes or colloidal gold-labeled antibodies. FABP3 is widely used in Life Sciences research as a target for studying cellular metabolism and lipid signaling pathways. Additionally, it serves as a valuable tool for developing inhibitors and monoclonal antibodies for therapeutic applications.</p>

<p>Purified recombinant ASPHD1 protein (His tag)</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR</p>

<p>Ciita antibody was raised in rabbit using CIITA peptide corresponding to a region near the N-terminus of the human protein conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal TPPP antibody</p>

<p>FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL</p>

<p>Portion of Influenza A</p>

<p>Rabbit polyclonal SPTAN1 antibody</p>

<p>The GPT Antibody is a polyclonal antibody that is commonly used in immunohistochemistry studies. It is an essential tool in the field of life sciences for detecting and analyzing various proteins and antigens. This antibody specifically targets the GPT protein, which is involved in numerous biological processes, including interferon signaling and chemokine binding.</p>

<p>The IGF1R antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the insulin-like growth factor 1 receptor (IGF1R) and has been shown to have cytotoxic effects on various types of cancer cells. This antibody can neutralize the activity of IGF1R, which is a key regulator of cell growth and proliferation. Additionally, it has been found to inhibit the expression of alpha-fetoprotein, a marker associated with liver cancer. The IGF1R antibody can also be used as an anti-connexin agent, blocking gap junction-mediated intercellular communication. In addition to its role in cancer research, this antibody has applications in studying adipose tissue development, endothelial growth factors, and nuclear signaling pathways.</p>

<p>CAV1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPLP0 antibody, catalog no. 70R-4936</p>

<p>DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL</p>

<p>PPM1M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL</p>

<p>IL2 antibody was raised in rat using recombinant Mouse IL-2 as the immunogen.</p>

<p>The BMPR1B protein is known for its role in endothelial growth and has anti-VEGF properties. It plays a crucial role in the regulation of cell proliferation, differentiation, and apoptosis. The protein is involved in various biological processes such as embryonic development, tissue homeostasis, and wound healing.</p>

<p>Mouse monoclonal SNX9 antibody</p>

<p>ZBTB6 antibody was raised in rabbit using the N terminal of ZBTB6 as the immunogen</p>

<p>Neuroketal antibody was raised in goat using neuroketal-Conjugate as the immunogen.</p>

<p>The CMKLR1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the alpha-fetoprotein, a protein associated with various diseases and conditions. This antibody can be used for a wide range of applications, including research, diagnostics, and therapeutics. It has been extensively tested and validated to ensure its high specificity and effectiveness.</p>

<p>The Osteopontin antibody is a highly effective monoclonal antibody that targets the protein osteopontin. It is specifically designed to bind to this protein and inhibit its activity. Osteopontin is involved in various biological processes, including cell adhesion, migration, and inflammation. By targeting osteopontin, this antibody can potentially have therapeutic applications in various diseases, including cancer and autoimmune disorders.</p>