Produits biochimiques et réactifs

<p>Rabbit polyclonal Seed G28 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF138 antibody, catalog no. 70R-8721</p>

<p>The MZF1 antibody is a monoclonal antibody that specifically targets and binds to the MZF1 protein. This protein is involved in various cellular processes, including the regulation of gene expression and cell differentiation. The MZF1 antibody can be used in research and diagnostic applications to study the role of MZF1 in different biological systems.</p>

<p>The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.</p>

<p>3,6-Dimethyl-4-pentan-3-yloxy-2-(2,4,6-trimethylphenoxy)pyridine is a drug that binds to the corticotropin releasing factor receptor (CRF) and the receptor for depression. This drug has been shown to be effective in clinical studies of depression and psychotic disorders. 3,6-Dimethyl-4-pentan-3-yloxy-2-(2,4,6-trimethylphenoxy)pyridine is a hydrogen bond donor and has a carbonyl group as one of its functional groups. This drug is used as a diluent in pharmaceuticals. 3,6 -Dimethyl -4 pentan -3 yloxy -2 ( 2, 4, 6 trim ethyl phenoxy ) pyridine has an acceptor group that can react with an electron pair donor such as oxygen. This drug also has properties that allow it to be</p>

<p>The MEK5 antibody is a monoclonal antibody that targets the MEK5 protein, which is involved in cell growth and survival. It has been shown to inhibit the growth of microvessels by blocking the activity of growth factors such as epidermal growth factor (EGF). This antibody specifically binds to the MEK5 protein, preventing its interaction with downstream signaling molecules and inhibiting cell proliferation. Additionally, the MEK5 antibody has been found to have cytotoxic effects on granulosa cells, potentially making it a promising therapeutic option for conditions involving abnormal cell growth. Its specificity and ability to target specific proteins make it a valuable tool in life sciences research.</p>

<p>ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KIR2DL1 antibody was raised in mouse using recombinant human kIR2DL1 (23-223 aa) purified from E. coli as the immunogen.</p>

<p>HS56 is an advanced biopolymer, which is derived from a proprietary synthesis of renewable sources. With its unique molecular configuration, this product stands out due to its sustainable origin and innovative production method. The mode of action involves its ability to form stable complexes with diverse substrates, which can enhance material properties such as strength, flexibility, and biodegradability.</p>

<p>Mouse monoclonal CKMT1 antibody</p>

<p>Mouse monoclonal CST3 antibody</p>

<p>PAPSS2 antibody was raised using the C terminal of PAPSS2 corresponding to a region with amino acids PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN</p>

<p>RUVBL1 antibody was raised in mouse using recombinant Human Ruvb-Like 1 (E. Coli) (Ruvbl1)</p>

<p>TRIM17 antibody was raised in rabbit using the middle region of TRIM17 as the immunogen</p>

<p>The NFKB1 antibody is a powerful tool used in Life Sciences research. It specifically targets the NFKB1 gene, which is an oncogene homolog involved in various cellular processes. This monoclonal antibody has been extensively validated and is widely used in bioassays to study the function and regulation of NFKB1.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTT1 antibody, catalog no. 70R-2157</p>

<p>TNF Receptor 1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize the activity of TNF receptor 1, a cell surface protein involved in various cellular processes. This antibody acts as a potent inhibitor of TNF receptor 1 signaling, which plays a crucial role in inflammation and immune response. The TNF Receptor 1 antibody has been extensively studied and proven to be effective in inhibiting the growth factor-induced activation of downstream pathways. It has also shown promising results in preclinical studies targeting diseases such as cancer and autoimmune disorders. With its high specificity and cytotoxic properties, this antibody holds great potential for therapeutic applications in targeted therapy. Whether used alone or in combination with other antibodies such as anti-VEGF or tyrosinase inhibitors, TNF Receptor 1 antibody offers a promising avenue for researchers and clinicians alike in their quest to combat various diseases effectively.</p>

<p>Lipoprotein Lipase Monoclonal Antibody Biotin</p>

<p>The LGR4 antibody is a powerful tool in the field of life sciences. It is a cytotoxic antibody that specifically targets and binds to LGR4, a histidine-rich receptor protein. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>Rat monoclonal T and B cell activation antigen antibody</p>

<p>Plectin antibody was raised in guinea pig using the C-Terminal “C” domain of recombinant human plectin as the immunogen.</p>

<p>Purified recombinant IL36G protein (His tag)</p>

<p>Mouse monoclonal TAF2 antibody</p>

<p>SLC9A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids INYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQT</p>

<p>Rabbit polyclonal SF3B2 antibody</p>

<p>The IgM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the molecule called mesothelin, which is found in the nucleus of cells. This antibody has cytotoxic properties and can effectively neutralize the urokinase plasminogen activator, which plays a role in cell migration and invasion.</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG</p>

<p>Armenian Hamster monoclonal CD119 antibody (PE)</p>

<p>Mouse monoclonal CD3 antibody (biotin)</p>

<p>CD44 Monoclonal Antibody (FITC)</p>

<p>GPR151 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.</p>

<p>Rabbit polyclonal AP2A1 antibody</p>

<p>HAAO antibody was raised using the N terminal of HAAO corresponding to a region with amino acids HRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVG</p>

<p>The VASP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor (EGF)-like domain of VASP (Vasodilator-stimulated phosphoprotein), a protein involved in cell adhesion and migration. This antibody has been extensively characterized and validated for its high specificity and affinity towards VASP.</p>

<p>Rabbit polyclonal NR2C1 antibody</p>

<p>Rabbit polyclonal GPR62 antibody</p>

<p>The IL17F antibody is a powerful tool in the field of Life Sciences. It is specifically designed to target and neutralize the effects of IL17F, an important cytokine involved in various inflammatory processes. This antibody has been extensively tested and proven to effectively block IL17F activity, making it a valuable asset in research and therapeutic applications.</p>

<p>The EpCAM antibody is a monoclonal antibody that has been developed through recombinant technology. It specifically targets the epithelial cell adhesion molecule (EpCAM), which is expressed on the surface of various types of cancer cells. By binding to EpCAM, this antibody inhibits the growth and spread of cancer cells.</p>

<p>Mouse monoclonal XRCC1 antibody</p>

<p>PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV</p>

<p>Chlamydia pneumoniae antibody was raised in Mouse using Chlamydia pneumoniae (TWAR) as the immunogen.</p>

<p>ATP6V1B1 antibody was raised using the middle region of ATP6V1B1 corresponding to a region with amino acids LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL</p>

<p>The AKT1 antibody is a highly effective colloidal solution that contains monoclonal antibodies. These antibodies specifically target and bind to the AKT1 protein, which plays a crucial role in various cellular processes. By binding to AKT1, the antibody inhibits its activity and prevents the activation of downstream signaling pathways.</p>

<p>Purified recombinant Human CHI3L1 protein (His tag)</p>