Produits biochimiques et réactifs

<p>CARD8 antibody was raised in mouse using recombinant Human Caspase Recruitment Domain Family, Member 8 (Card8)</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-6264</p>

<p>MPZL2 antibody was raised in Rabbit using Human MPZL2 as the immunogen</p>

<p>Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE</p>

<p>Rabbit polyclonal CDKAL antibody</p>

<p>The Presenilin 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Presenilin 1, a protein involved in the processing of fatty acids and acidic compounds. This antibody has been extensively studied for its role in various cellular processes, including the regulation of interleukin-6, epidermal growth factor, annexin proteins, erythropoietin, and natriuretic factors. Researchers use this antibody to investigate the function and interactions of Presenilin 1 in different biological systems. Additionally, polyclonal antibodies are also available for wider applications. These antibodies are valuable tools for scientists studying growth factors, signaling pathways, and disease mechanisms. With their high specificity and sensitivity, both monoclonal and polyclonal Presenilin 1 antibodies provide reliable results for researchers in need of accurate protein detection and analysis.</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser208)</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (PE)</p>

<p>CCDC22 antibody was raised in Rabbit using Human CCDC22 as the immunogen</p>

<p>Recombinant Human HYKK protein</p>

<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>

<p>Purified recombinant MBP protein (His tag)</p>

<p>Rat monoclonal CD25 antibody (biotin)</p>

<p>The POR antibody is a highly specialized antibody that targets the messenger RNA (mRNA) of the primary amino acid sequence of the POR protein. This antibody is designed to specifically bind to the POR protein and can be used in various research applications, such as Western blotting, immunohistochemistry, or flow cytometry.</p>

<p>The ERK2 antibody is a highly specific monoclonal antibody that targets the extracellular signal-regulated kinase 2 (ERK2). This antibody plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. It is commonly used in research and diagnostic applications to study the activation of ERK signaling pathways.</p>

<p>Erythropoietin protein is a long-acting preparation of endogenous erythropoietin, a hormone that stimulates the production of red blood cells. This protein has been shown to have various effects on different cell types. It regulates the synthesis and secretion of TGF-beta in human hepatocytes, which plays a crucial role in tissue repair and fibrosis. Erythropoietin protein can also modulate chemokine expression and enhance the migration of immune cells to sites of inflammation. Additionally, it has been used as a conjugated protein with monoclonal antibodies for targeted drug delivery. Erythropoietin protein is commonly used in the field of life sciences for research purposes and as an ingredient in pharmaceutical formulations. It can be combined with other drugs such as ketorolac, gabapentin, or imatinib to enhance their therapeutic effects. The formulation may contain excipients like collagen to improve stability and bioavailability. With its diverse applications and potent biological activity</p>

<p>The L1CAM antibody is a highly activated monoclonal antibody that targets CD33, a protein found on the surface of adipose cells. This antibody is reactive and has been extensively studied in the field of Life Sciences. It has been shown to have neutralizing properties, inhibiting the growth factor signaling pathways associated with adipose tissue development. Additionally, this antibody has hepatoprotective effects, protecting liver cells from damage caused by lipofuscin accumulation. The L1CAM antibody can also activate phosphatase and 3-kinase enzymes, which play crucial roles in cellular signaling pathways. With its high specificity and potency, this monoclonal antibody is an excellent tool for research and therapeutic applications in various fields.</p>

<p>ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT</p>

<p>KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR</p>

<p>RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW</p>

<p>Purified recombinant NPPC protein (His tag)</p>

<p>Purified Polyclonal Plexin A2 antibody</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Purified Rabbit polyclonal IKK gamma antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>

<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>

<p>Rabbit polyclonal Osteopontin antibody (biotin)</p>

<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>

<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>

<p>Rabbit polyclonal RCBTB2 antibody</p>

<p>Rabbit polyclonal NA14 antibody</p>

<p>LAD1 antibody was raised in Rabbit using Human LAD1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2D3 antibody</p>

<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL</p>

<p>The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.</p>

<p>E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>The CD3E antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and neutralizes alpha-fetoprotein, a protein complex found in human serum. The CD3E antibody has been extensively studied for its binding properties to steroid binding proteins, particularly those involved in nuclear receptor signaling pathways. This antibody is known for its high affinity and specificity, making it an ideal tool for research and diagnostic applications. Whether you are studying protein-protein interactions or investigating the role of specific molecules in cellular processes, the CD3E antibody is an essential tool in your arsenal. Trust this monoclonal antibody to deliver accurate and reliable results for all your scientific endeavors.</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>The Chlorpromazine antibody is a highly specialized monoclonal antibody that specifically targets and binds to chlorpromazine, a metal-binding protein. This multispecific antibody is designed to recognize and bind to specific lysine and acid residues on chlorpromazine molecules. The Chlorpromazine antibody can be used in various applications, such as immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>Rabbit Polyclonal KIF11 antibody (Thr926)</p>

<p>The DLAT antibody is a highly specialized monoclonal antibody that has been developed for use in various life sciences applications. It is designed to specifically target and bind to DLAT, also known as dihydrolipoamide S-acetyltransferase. This protein plays a crucial role in the function of the pyruvate dehydrogenase complex, which is involved in energy metabolism.</p>

<p>Rabbit polyclonal cRAF antibody (Thr269)</p>

<p>PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD</p>

<p>Mouse monoclonal C16orf72 antibody</p>

<p>Conjugated Benzodiazepine-BSA hapten</p>