Produits biochimiques et réactifs

<p>The CD41 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the CD41 protein, which is involved in various biological processes such as collagen binding and TGF-beta signaling. This antibody is highly effective in detecting and quantifying CD41 expression levels in different cell types.</p>

<p>DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids QKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK</p>

<p>ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA</p>

<p>TNFRSF11B antibody was raised in Mouse using a purified recombinant fragment of human TNFRSF11B expressed in E. coli as the immunogen.</p>

<p>Purified recombinant SH3BGRL3 protein (His tag)</p>

<p>Rabbit polyclonal SPERT antibody</p>

<p>Ceftiofur Conjugate for use in immunoassays</p>

<p>GOSR2 antibody was raised in Rabbit using Human GOSR2 as the immunogen</p>

<p>Rat monoclonal B7RP1 antibody (PE)</p>

<p>Cytokeratin 19 antibody is a low-molecular-weight monoclonal antibody that specifically binds to cytokeratin 19, a protein found in epithelial cells. This antibody has been used in various applications in the field of life sciences, including research and diagnostics. It can be used to detect and quantify cytokeratin 19 expression in tissues and cells, making it a valuable tool for studying epithelial cell biology. The dextran sulfate conjugated to the antibody enhances its stability and allows for efficient binding to target molecules. Whether you're conducting experiments or developing new diagnostic assays, this cytokeratin 19 antibody is an essential component for your research toolkit. Trust its high specificity and sensitivity to deliver accurate and reliable results.</p>

<p>Rabbit polyclonal TXLNA antibody</p>

<p>ELISA buffer for optimal coating and binding of antibodies and antigens</p>

<p>CD4 antibody (PE) was raised in mouse using human CD4 as the immunoge.</p>

<p>Rabbit polyclonal Kinase E9 antibody</p>

<p>Purified recombinant DOK4 protein (His tag)</p>

<p>The SMAD3 antibody is a powerful tool in the field of molecular biology and immunology. It is a polyclonal antibody that specifically targets the SMAD3 protein, which plays a crucial role in various cellular processes such as chemokine signaling, multidrug resistance, and growth factor regulation. This antibody binds to the SMAD3 protein with high affinity and specificity, allowing researchers to study its function and interactions in different experimental settings.</p>

<p>Rabbit polyclonal RGS20 antibody</p>

<p>The TSP1 antibody is a powerful tool used in Life Sciences. It is an antibody that specifically targets and binds to fibrinogen, a glycoprotein involved in blood clotting. This polyclonal antibody can be used in various applications, such as immunohistochemistry and Western blotting, to detect and quantify the presence of fibrinogen in biological samples. Additionally, the TSP1 antibody has been shown to have cytotoxic effects on cells expressing TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. This monoclonal antibody has also been used in combination with other inhibitors, such as adalimumab, to block the activity of TNF-α, a key mediator of inflammation. With its high specificity and versatility, the TSP1 antibody is an essential component for any researcher working in the field of Life Sciences.</p>

<p>Rabbit polyclonal IL1b antibody (biotin)</p>

<p>Rabbit polyclonal TBCA antibody</p>

<p>FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR</p>

<p>NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI</p>

<p>Rabbit polyclonal ZNF643 antibody</p>

<p>ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogen</p>

<p>Mouse monoclonal SULT1C2 antibody</p>

<p>Kcnip3 antibody was raised in rabbit using the middle region of Kcnip3 as the immunogen</p>

<p>Purified recombinant NRIP3 protein (His tag)</p>

<p>PGM1 protein is an EGF-like protein that exhibits growth factor activity. It has been shown to promote the growth and differentiation of hepatocyte-like cells. Monoclonal antibodies specific to PGM1 have been developed and can be used for various applications, including hybridization assays and radionuclide imaging. These antibodies have neutralizing properties, which means they can inhibit the biological activity of PGM1. In addition, PGM1 has been found to have a stimulatory effect on TGF-beta signaling pathway and collagen production in liver microsomes. Overall, PGM1 protein plays a crucial role in cellular growth and tissue development.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>CDKN1B antibody was raised in Mouse using a purified recombinant fragment of human CDKN1B expressed in E. coli as the immunogen.</p>

<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL</p>

<p>Rabbit polyclonal SRM antibody</p>

<p>Phenylbutazone antibody is a polyclonal antibody that specifically targets and binds to phenylbutazone, a nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively tested for its inhibition concentration against other NSAIDs such as ibuprofen, aminopyrine, piroxicam, and indomethacin. It is widely used in the field of Life Sciences for research purposes. The structural formula of phenylbutazone is available upon request. Phenylbutazone antibody is a valuable tool for studying the pharmacokinetics and pharmacodynamics of this drug and its interactions with other compounds. With its high specificity and sensitivity, this antibody ensures accurate and reliable results in various immunoassays.</p>

<p>Mouse monoclonal KATNAL1 antibody</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK</p>

<p>Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit Polyclonal OR2T1 antibody</p>

<p>Rabbit polyclonal RTN4R antibody</p>

<p>Mouse monoclonal Toll-like receptor 2 antibody (FITC)</p>

<p>KIF3C antibody was raised using the middle region of KIF3C corresponding to a region with amino acids LQEQKERLEEEKAAIQDDRSLVSEEKQKLLEEKEKMLEDLRREQQATELL</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids PRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSSTSQRISVELPVPI</p>

<p>GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal RPLP2 antibody</p>

<p>HCFC1R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM</p>

<p>HECTD3 antibody was raised in Rabbit using Human HECTD3 as the immunogen</p>

<p>EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA</p>

<p>KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL</p>

<p>The PLXDC2 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to specifically target and neutralize the activity of PLXDC2, a glycoconjugate receptor involved in various cellular processes. This antibody has been shown to be cytotoxic against cells expressing high levels of PLXDC2, making it a promising tool for targeted therapy.</p>

<p>Purified recombinant TNFRSF14 protein (His tag)</p>