Produits biochimiques et réactifs

<p>Dopamine-BSA is a peptide agent that consists of dopamine conjugated with Bovine Serum Albumin (BSA). It is commonly used in life sciences research for various applications. Dopamine-BSA has been found to interact with collagen, antibodies, and angiotensin-converting enzyme. It can also be used as a tool for studying the role of dopamine in different biological processes.</p>

<p>The NMT2 antibody is a monoclonal antibody that specifically targets leukemia inhibitory factor (LIF). LIF is a glycoprotein that plays a crucial role in various biological processes, including cell proliferation and differentiation. This antibody has been shown to neutralize the activity of LIF, making it a potential therapeutic option for conditions where LIF overexpression is implicated.</p>

<p>Rabbit polyclonal OVCA1 antibody</p>

<p>Mouse monoclonal CORO1B antibody</p>

<p>Purified recombinant RPL22 protein (His tag)</p>

<p>The HAMA Blocking Reagent is a reactive compound commonly used in Life Sciences research. It is designed to block the interference caused by Human Anti-Mouse Antibodies (HAMA) in various assays and experiments.</p>

<p>Rabbit polyclonal ARF4 antibody</p>

<p>ZNF778 antibody was raised in rabbit using the N terminal of ZNF778 as the immunogen</p>

<p>Purified Rabbit polyclonal INSP3 antibody (Ser1598/1588)</p>

<p>Rabbit polyclonal AIRE antibody</p>

<p>GRO beta antibody was raised in rabbit using highly pure recombinant rat GRObeta/MIP-2 as the immunogen.</p>

<p>Rabbit polyclonal TBC1D5 antibody</p>

<p>The PAK2 antibody is a monoclonal antibody that specifically targets the insulin receptor, a nuclear receptor that plays a crucial role in regulating growth factors and insulin signaling pathways. This antibody binds to the insulin receptor and inhibits its activity, thereby modulating the response to insulin. The PAK2 antibody has been extensively studied in various life sciences research applications, including studies on dopamine signaling, protein synthesis, thymidylate synthesis, and epidermal growth factor signaling. Additionally, this antibody has shown potential therapeutic value in targeting specific proteins such as anti-HER2 antibodies and autoantibodies found in human serum. With its high specificity and versatility, the PAK2 antibody is an invaluable tool for researchers in the field of molecular biology and immunology.</p>

<p>The mGLUR5 antibody is a monoclonal antibody that specifically targets and binds to the metabotropic glutamate receptor 5 (mGLUR5). This antibody is widely used in research and diagnostic applications to study the function and expression of mGLUR5. It has been shown to be effective in detecting autoantibodies in human serum, including anti-thyroglobulin antibodies. The mGLUR5 antibody also exhibits high affinity for sorafenib, a growth factor receptor inhibitor, and demonstrates strong binding to serum albumin due to its reactive disulfide bond and cationic properties. Additionally, this specific antibody has been successfully used in studies involving phosphatase activity.</p>

<p>PPAR gamma antibody is a specific antibody that targets the peroxisome proliferator-activated receptor gamma (PPAR gamma). This antibody is widely used in Life Sciences research to study the functions and signaling pathways of PPAR gamma. PPAR gamma plays a crucial role in regulating gene expression involved in adipogenesis, insulin sensitivity, lipid metabolism, and inflammation. The PPAR gamma antibody has been shown to inhibit IL-17A-induced growth factor secretion in granulosa cells and promote the expression of E-cadherin. It can also be used for immunohistochemistry and immunofluorescence experiments to detect PPAR gamma expression levels in various tissues and cell types. This monoclonal antibody offers high specificity and sensitivity, making it an essential tool for researchers studying PPAR gamma-related diseases such as obesity, diabetes, and cancer.</p>

<p>Rabbit polyclonal MCM4 antibody</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>DEDD2 antibody was raised in rabbit using residues 144-129 of the DEDD2 protein as the immunogen.</p>

<p>CAMK4 antibody was raised in Rabbit using Human CAMK4 as the immunogen</p>

<p>Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>ASAP3 antibody was raised using the N terminal of ASAP3 corresponding to a region with amino acids RGAALAREEILEGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLG</p>

<p>The TP53 antibody is a growth factor that acts as a functional sweetener. It belongs to the class of antibodies and specifically targets the TP53 protein, which plays a crucial role in regulating cell division and preventing tumor formation. This monoclonal antibody has been extensively studied and shown to have neutralizing effects on the TP53 protein, thereby inhibiting its activity and promoting cell growth. It is widely used in life sciences research, particularly in studies related to cancer biology and immunology. The TP53 antibody has also been investigated for its potential therapeutic applications, including as a targeted treatment for certain types of cancer. Overall, this molecule drug shows great promise in advancing our understanding of cellular processes and developing novel therapies.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>4-[5-Phenyl-3-[3-[N′-(4-trifluoromethylphenyl)ureido]propyl]pyrazol-1-yl]benzenesulfonamide is an anticancer drug that acts as a kinase inhibitor. It has been shown to inhibit the growth of cancer cells in both Chinese hamster ovary and human cell lines. This analog has been found to induce apoptosis, or programmed cell death, in tumor cells. It is primarily excreted in urine and has demonstrated potent inhibitory activity against multiple kinases, including protein kinases A, B, and C. 4-[5-Phenyl-3-[3-[N′-(4-trifluoromethylphenyl)ureido]propyl]pyrazol-1-yl]benzenesulfonamide is also known as nintedanib and is currently used as an inhibitor for the treatment of idiopathic pulmonary fibrosis</p>

<p>The Vimentin antibody is a monoclonal antibody used in Life Sciences research. It specifically targets vimentin, a protein that forms intermediate filaments and plays a crucial role in maintaining cell structure and integrity. This antibody can be used to study various cellular processes such as cell migration, adhesion, and differentiation. Additionally, it has been shown to be effective in detecting vimentin expression in different cell types and tissues. The Vimentin antibody is also commonly used in immunohistochemistry and Western blotting experiments. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying vimentin-related pathways and diseases.</p>

<p>Rabbit polyclonal UNC45A antibody</p>

<p>The Cytokeratin 8 antibody is a recombinant monoclonal antibody that serves as a diagnostic reagent for various applications. It is specifically designed to target cytokeratin 8, a protein found in liver microsomes and human serum. This antibody can be used in immunohistochemistry, Western blotting, and other techniques for the detection and analysis of cytokeratin 8 expression.</p>

<p>SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP</p>

<p>Mouse monoclonal RPTP antibody</p>

<p>STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL</p>

<p>PML antibody was raised in rabbit using the C terminal of PML as the immunogen</p>

<p>EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV</p>

<p>Purified recombinant ID2 protein (His tag)</p>

<p>Mouse monoclonal FOXO1 antibody (C-terminus)</p>

<p>alpha 1 Antiplasmin Matched Pair antibody Set for ELISA</p>

<p>ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM</p>

<p>The MSH6 antibody is a powerful tool used in life sciences research. It belongs to the family of polyclonal antibodies and has neutralizing properties. This antibody specifically targets the protein MSH6, which plays a crucial role in DNA repair and maintenance of genomic stability. By binding to MSH6, this antibody inhibits its activity and prevents it from interacting with other proteins involved in DNA repair processes.</p>

<p>ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV</p>

<p>Rat monoclonal B7H4 antibody (PE)</p>

<p>Purified Polyclonal MCT13 antibody</p>

<p>Rabbit polyclonal SPATA7 antibody</p>

<p>Purified Rabbit polyclonal CEP78 antibody</p>

<p>KYNU antibody was raised in Rabbit using Human KYNU as the immunogen</p>

<p>FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH</p>

<p>Rabbit polyclonal SDF4 antibody</p>

<p>Purified recombinant Dengue NS1 protein (Serotype 1) (His tag)</p>

<p>TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA</p>

<p>The LY6E antibody is a highly activated monoclonal antibody that belongs to the class of anti-CD20 antibodies. It is commonly used in Life Sciences research for its ability to target and bind to specific proteins, such as glucose transporters and protein kinases, which play crucial roles in various cellular processes. The LY6E antibody has been shown to exhibit cytotoxic effects on targeted cells, leading to their destruction. Additionally, it has been found to interact with mitogen-activated protein (MAP) pathways and nuclear tyrosine residues, further enhancing its therapeutic potential. This antibody has also demonstrated promising results in inhibiting the activity of alpha-synuclein, a protein associated with neurodegenerative disorders like Parkinson's disease. Moreover, the LY6E antibody has shown excellent stability and specificity when tested in human serum samples. With its diverse applications and impressive performance, this antibody is a valuable tool for researchers in fields such as immunology, oncology, and neuroscience.</p>

<p>The TGM4 antibody is a polyclonal antibody that is used in the field of Life Sciences. It is commonly used in research studies involving human serum and electrode analysis. This antibody specifically targets TGM4, a protein complex involved in various cellular processes. Additionally, the TGM4 antibody has been shown to have neutralizing effects on certain growth factors, such as human chorionic gonadotropin and endothelial growth factor. Furthermore, it has been found to bind to necrosis factor-related apoptosis-inducing ligand (TRAIL), suggesting its potential role in modulating cell death pathways. Whether you're conducting groundbreaking research or exploring new avenues in the field of Life Sciences, the TGM4 antibody can be a valuable tool for your experiments.</p>