Produits biochimiques et réactifs

<p>STXBP1 antibody is a highly specialized antibody used in the field of life sciences. It is commonly used for research purposes in the study of growth factors, insulin, and various other proteins. This antibody has shown efficacy in targeting specific proteins such as trastuzumab, an anti-HER2 antibody, and lipoprotein lipase. Additionally, it has been found to interact with interleukin-6 and epidermal growth factor.</p>

<p>ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND</p>

<p>Purified recombinant DUSP22 protein (His tag)</p>

<p>The Notch 1 antibody is a highly reactive protein that belongs to the class of antibodies. It is specifically designed to target and bind to the glial fibrillary acidic protein (GFAP), which is commonly found in human serum. This monoclonal antibody has been extensively tested and validated using various techniques, including particle chemiluminescence and immunoassays.</p>

<p>The PIAS2 antibody is a highly specialized antibody that plays a crucial role in the body's immune response. It belongs to the chemokine family and has been found to be polymorphic, meaning it can vary in structure among individuals. This antibody is particularly important in intraocular immunity, where it helps protect the eyes from various pathogens.</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>MED4 antibody was raised in Rabbit using Human MED4 as the immunogen</p>

<p>Purified Rabbit polyclonal PNPLA8 antibody</p>

<p>Purified Polyclonal IRAK2 antibody</p>

<p>ITGA4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal C1QB antibody</p>

<p>CA5B antibody was raised in Rabbit using Human CA5B as the immunogen</p>

<p>SLIT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC</p>

<p>Rabbit polyclonal WRKY63 antibody</p>

<p>Mouse monoclonal EIF4E2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its potency has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI</p>

<p>Purified Polyclonal BAF53A antibody</p>

<p>1-202 amino acids: MGSSHHHHHH SSGLVPRGSH MCRTLAAFPT TCLERAKEFK TRLGIFLHKS ELGCDTGSTG KFEWGSKHSK ENRNFSEDVL GWRESFDLLL SSKNGVAAFH AFLKTEFSEE NLEFWLACEE FKKIRSATKL ASRAHQIFEE FICSEAPKEV NIDHETRELT RMNLQTATAT CFDAAQGKTR TLMEKDSYPR FLKSPAYRDL AAQASAASAT LSSCSLDEPS HT</p>

<p>Mouse monoclonal ACTN1 antibody</p>

<p>Recombinant Human XPNPEP1 protein with His tag</p>

<p>The Tenascin antibody is a monoclonal antibody that specifically targets the protein tenascin. Tenascin is a large extracellular matrix glycoprotein that plays a role in cell adhesion and migration during embryogenesis and tissue remodeling. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>ITFG1 antibody was raised in Rabbit using Human ITFG1 as the immunogen</p>

<p>Adenovirus antibody was raised in mouse using the hexon group antigen of numerous ADV serotypes as the immunogen.</p>

<p>MOSPD2 antibody was raised using the middle region of MOSPD2 corresponding to a region with amino acids TPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST</p>

<p>The Kv1.3 antibody is a highly specialized monoclonal antibody with cytotoxic properties. It is used as an immunomodulatory agent and has shown promising results as an anticancer therapy. This antibody works by neutralizing the activity of Kv1.3, a potassium channel that plays a crucial role in cell proliferation and survival.</p>

<p>The NMT2 antibody is a growth factor that targets nuclear epidermal growth factor. It belongs to the class of inhibitors known as monoclonal antibodies. This antibody specifically targets tyrosine and has shown promising results in inhibiting the growth of various cancer cells, including those resistant to other treatments such as trastuzumab. The NMT2 antibody is particularly effective against HER2-positive cancers, as it acts as an anti-HER2 antibody. Additionally, this antibody has shown potential in targeting other proteins such as c-myc, epidermal growth factor, and alpha-synuclein. Its specificity for nucleotide molecules makes it a valuable tool for research and therapeutic applications. With its unique properties and high affinity for its target, the NMT2 antibody offers exciting possibilities in the field of cancer treatment and beyond.</p>

<p>Mouse monoclonal CD158f antibody (PE)</p>

<p>Rabbit polyclonal ROMK antibody (Ser44/25)</p>

<p>The ZFP36 antibody is a substance that acts as an inhibitor and belongs to the class of monoclonal antibodies. It has been used in the field of medicine and life sciences for various applications. The ZFP36 antibody has shown potential as an HDAC inhibitor, which means it can inhibit the activity of histone deacetylases. This inhibition can lead to changes in gene expression and cellular processes.</p>

<p>C17ORF57 antibody was raised using the N terminal Of C17Orf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL</p>

<p>FGF21 antibody is a monoclonal antibody that specifically targets and inhibits the activity of fibroblast growth factor 21 (FGF21). FGF21 is a growth factor that plays a crucial role in regulating metabolism and energy balance. By blocking the action of FGF21, this antibody can potentially have therapeutic applications in various diseases related to metabolic disorders, such as obesity and type 2 diabetes.</p>

<p>30-241 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMFS PYVFNGGTIL AIAGEDFAIV ASDTRLSEGF SIHTRDSPKC YKLTDKTVIG CSGFHGDCLT LTKIIEARLK MYKHSNNKAM TTGAIAAMLS TILYSRRFFP YYVYNIIGGL DEEGKGAVYS FDPVGSYQRD SFKAGGSASA MLQPLLDNQV GFKNMQNVEH VPLSLDRAMR LVKDVFISAA ERDVYTGDAL RICIVTKEGI REETVSLRKD</p>

<p>Purified recombinant CIAO1 protein (His tag)</p>

<p>Armenian Hamster monoclonal CD69 antibody (FITC)</p>

<p>Recombinant Human ZADH2 protein</p>

<p>GRK5 antibody was raised in Rabbit using Human GRK5 as the immunogen</p>

<p>Rat monoclonal CD115 antibody (biotin)</p>

<p>The eNOS antibody is a polyclonal antibody that targets the endothelial nitric oxide synthase (eNOS) protein. This protein plays a crucial role in regulating blood flow and maintaining vascular health. The eNOS antibody can be used for various research applications, including studying the effects of growth factors, creatine, and other molecules on eNOS activity.</p>

<p>LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS</p>

<p>ZNF205 antibody was raised in rabbit using the middle region of ZNF205 as the immunogen</p>

<p>FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS</p>

<p>PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG</p>

<p>CNN3 antibody was raised in rabbit using the C terminal of CNN3 as the immunogen</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>Akt, also known as Protein Kinase B (PKB), is a critical signaling protein in cells that regulates essential processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth, which is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. This allows Akt to influence downstream processes, promoting cell survival by inhibiting apoptosis, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism—especially important for insulin response.Akt plays a significant role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>MRGPRX2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal NME4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF1A antibody, catalog no. 70R-5534</p>

<p>Rabbit polyclonal SFRS2 antibody</p>