Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.570 produits)
- Par Biological Target(100.766 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(477 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
DIS3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DIS3 antibody, catalog no. 70R-4678Degré de pureté :Min. 95%Rabbit anti Human IgG (HRP)
Rabbit anti-human IgG (HRP) was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.Degré de pureté :Min. 95%CEACAM6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM6 antibody, catalog no. 70R-3099Degré de pureté :Min. 95%HAX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAX1 antibody, catalog no. 70R-2546Degré de pureté :Min. 95%Factor II Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of F2 antibody, catalog no. 70R-5680Degré de pureté :Min. 95%KCTD4 antibody
KCTD4 antibody was raised using the N terminal of KCTD4 corresponding to a region with amino acids MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLSTAT5A antibody
The STAT5A antibody is a powerful tool in the field of Life Sciences. It specifically targets and detects the STAT5A protein, which plays a crucial role in various cellular processes. This antibody is highly specific and can be used for a range of applications including immunohistochemistry, Western blotting, and ELISA.
Degré de pureté :Min. 95%Rabbit anti Mouse Kappa Chain (Texas Red)
Rabbit anti-mouse kappa chain was raised in rabbit using murine kappa light chain as the immunogen.FBXL5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL5 antibody, catalog no. 70R-1150Degré de pureté :Min. 95%RAB5C antibody
RAB5C antibody was raised in rabbit using the middle region of RAB5C as the immunogenDegré de pureté :Min. 95%NUDT16L1 antibody
NUDT16L1 antibody was raised in rabbit using the middle region of NUDT16L1 as the immunogenDegré de pureté :Min. 95%Hemoglobin Zeta antibody
Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAZNF764 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF764 antibody, catalog no. 70R-9588Degré de pureté :Min. 95%TRIM43 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM43 antibody, catalog no. 70R-2814
Degré de pureté :Min. 95%ACADVL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACADVL antibody, catalog no. 70R-9269Degré de pureté :Min. 95%Pkib antibody
Pkib antibody was raised in rabbit using the middle region of Pkib as the immunogenDegré de pureté :Min. 95%Tau antibody
The Tau antibody is a powerful tool in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets and neutralizes the effects of tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's. This antibody has been extensively studied and proven to inhibit the aggregation of tau protein, preventing the formation of toxic tangles in the brain. Additionally, it has shown cytotoxic properties against cancer cells and has potential applications in cancer research. The Tau antibody is highly specific and can be used for various techniques including immunohistochemistry, immunofluorescence, and western blotting. With its ability to target multiple isoforms of tau protein, this antibody is an invaluable tool for researchers studying neurodegenerative disorders and cancer biology.Degré de pureté :Min. 95%FAK antibody
FAK antibody was raised in Mouse using a purified recombinant fragment of FAK expressed in E. coli as the immunogen.GATA4 antibody
GATA4 antibody was raised in Mouse using a purified recombinant fragment of human GATA4 expressed in E. coli as the immunogen.IGSF1 antibody
IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
Goat anti Human IgG + IgA + IgM
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.Degré de pureté :Min. 95%SPPL2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPPL2B antibody, catalog no. 70R-6412Degré de pureté :Min. 95%Syntaxin 19 antibody
Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR
PDK1 antibody
The PDK1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets and binds to PDK1, a key enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be highly specific and sensitive in detecting PDK1 in various biological samples.FGF2 protein
FGF2 protein, also known as fibroblast growth factor-2, is a growth factor that plays a crucial role in various biological processes. It is a collagen-binding protein that stimulates cell proliferation, differentiation, and migration. FGF2 protein has been extensively studied in the field of Life Sciences and has shown promising results in tissue regeneration and wound healing.Degré de pureté :Min. 95%FAM71A antibody
FAM71A antibody was raised in rabbit using the C terminal of FAM71A as the immunogenDegré de pureté :Min. 95%TrkB antibody
TrkB antibody is a high-quality polyclonal antibody that specifically targets the TrkB receptor, which is a member of the tropomyosin receptor kinase (Trk) family. This antibody is buffered and optimized for use in various applications in the field of life sciences.Degré de pureté :Min. 95%MBNL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MBNL2 antibody, catalog no. 70R-9089Degré de pureté :Min. 95%RAB35 antibody
RAB35 antibody was raised in rabbit using the middle region of RAB35 as the immunogen
Degré de pureté :Min. 95%LDHB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LDHB antibody, catalog no. 70R-3734Degré de pureté :Min. 95%TARBP2 antibody
TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTATP6V0C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0C antibody, catalog no. 70R-6564Degré de pureté :Min. 95%Chymotrypsin-Like Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTRL antibody, catalog no. 70R-5490Degré de pureté :Min. 95%Goat anti Human IgG + IgA + IgM (H + L) (HRP)
Goat anti-human IgG/IgA/IgM (H+L) (HRP) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.
Degré de pureté :Min. 95%Collagen Type IV α 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of COL4A3BP antibody, catalog no. 70R-5733Degré de pureté :Min. 95%
