Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.117 produits)
- Par Biological Target(99.161 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.705 produits)
- Métabolites secondaires(14.220 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SSH3 antibody
<p>The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.</p>NCKIPSD antibody
<p>NCKIPSD antibody was raised in rabbit using the middle region of NCKIPSD as the immunogen</p>Degré de pureté :Min. 95%UBAC2 antibody
<p>UBAC2 antibody was raised using the middle region of UBAC2 corresponding to a region with amino acids YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL</p>Degré de pureté :Min. 95%GNA12 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNA12 antibody, catalog no. 70R-3131</p>Degré de pureté :Min. 95%hnRNPF antibody
<p>The hnRNPF antibody is a highly specialized diagnostic reagent used in Life Sciences research. This monoclonal antibody specifically targets and binds to the hnRNPF protein complex, which plays a crucial role in regulating gene expression and RNA processing. The hnRNPF antibody can be used for various applications, including western blotting, immunohistochemistry, and ELISA assays.</p>Goat anti Human IgM (mu chain) (biotin)
<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>Degré de pureté :Min. 95%MDK74978
CAS :<p>MDK74978 is a small molecule that binds to the ATP-binding site of the HIF-1α kinase and inhibits its activity. It has been shown to inhibit the activity of other multi-kinase enzymes, such as PKCθ, Akt, and ERK1/2. MDK74978 has shown efficacy in animal models for treatment of iron overload disorders, such as hereditary hemochromatosis (HFE) and thalassemia major (HBA). In these models, MDK74978 improved iron homeostasis by increasing hepcidin synthesis in hepatocytes. This drug also showed efficacy in a mouse model with chronic kidney disease (CKD), which may be due to its ability to regulate erythropoietin production and enhance erythropoiesis.</p>Formule :C20H17F3N4O3Degré de pureté :Min. 95%Masse moléculaire :418.38 g/molCCRL2 antibody
<p>The CCRL2 antibody is a highly specialized monoclonal antibody that belongs to the class of antibodies known as chimeric proteins. It exhibits cytotoxic properties and has been extensively studied in the field of Life Sciences. This antibody specifically targets endothelial growth factor receptors, inhibiting their activity and preventing the growth and proliferation of cells.</p>ARMCX6 antibody
<p>ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW</p>Pyrazolo(3,4-D)pyrimidine
CAS :<p>Pyrazolo(3,4-D)pyrimidine is a ligand that binds to Ion channels and can be used as a research tool for pharmacology. It has been shown to inhibit the activity of G protein-coupled receptors, including Ligand receptor interactions. Pyrazolo(3,4-D)pyrimidine is also an activator of the extracellular signal regulated kinases 1/2 (ERK1/2), which are signaling molecules involved in cell growth, differentiation and survival. This agent has been shown to activate the ERK1/2 pathway by binding to a specific sequence in the cytoplasmic domain of epidermal growth factor receptor (EGFR). Pyrazolo(3,4-D)pyrimidine is known as a high purity compound and has been shown to inhibit antibody production in some cases.</p>Formule :C33H39N9O2Degré de pureté :Min. 95%Masse moléculaire :593.7 g/molLPL antibody
<p>The LPL antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to target and bind to lipoprotein lipase (LPL), an enzyme involved in the breakdown of triglycerides. The LPL antibody is made using advanced polymerase chain techniques, ensuring high specificity and sensitivity.</p>Factor VIII Antibody Pair Kit
<p>ELISA matched pair kit for detection of Human Factor VIII C in the research laboratory</p>Degré de pureté :Min. 95%Vitamin D BSA Conjugate
<p>Vitamin D Bovine Serum Albumin (BSA) Conjugate</p>Degré de pureté :Min. 95%RCE1 antibody
<p>RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF</p>WDR5 antibody
<p>WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen</p>Degré de pureté :Min. 95%CTDSP2 antibody
<p>CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA</p>C14ORF180 antibody
<p>C14ORF180 antibody was raised using the middle region of C14Orf180 corresponding to a region with amino acids PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG</p>Degré de pureté :Min. 95%MCL1 antibody
<p>The MCL1 antibody is a powerful tool in the field of immunology and biomedical research. This monoclonal antibody specifically targets the MCL1 protein, which plays a crucial role in cell survival and apoptosis regulation. The MCL1 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>KIF3A antibody
<p>KIF3A antibody was raised using the C terminal of KIF3A corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR</p>Degré de pureté :Min. 95%PDE7B antibody
<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%CHD6 antibody
<p>CHD6 antibody was raised in mouse using recombinant Human Chromodomain Helicase Dna Binding Protein 6 (Chd6)</p>RALYL antibody
<p>RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD</p>Cystatin C protein
<p>Cystatin C protein is a vital component of the Proteins and Antigens group. It contains an amino group that plays a crucial role in various biological processes. This protein can be targeted using monoclonal antibodies for diagnostic purposes. Cystatin C protein has been studied extensively for its association with autoimmune disorders such as antiphospholipid antibodies and heparin-induced thrombocytopenia. It also interacts with other molecules like epidermal growth factor, caffeine, and fatty acids, affecting their functions. Additionally, cystatin C protein has been linked to interferon signaling pathways and β-catenin regulation. Its importance in low-density lipoprotein metabolism and anticoagulation has also been established in the field of Life Sciences.</p>Degré de pureté :Min. 95%DCN protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target and treat tuberculosis infections. With its bactericidal activity, it effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been proven to be highly effective in human erythrocytes using the patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Degré de pureté :Min. 95%ARC antibody
<p>ARC antibody was raised in rabbit using the N terminal of ARC as the immunogen</p>Degré de pureté :Min. 95%LRRN3 antibody
<p>LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL</p>Degré de pureté :Min. 95%GJD4 antibody
<p>GJD4 antibody was raised using the middle region of GJD4 corresponding to a region with amino acids HTKIPDEDESEVTSSASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPS</p>Degré de pureté :Min. 95%SMP30 antibody
<p>The SMP30 antibody is a highly specialized monoclonal antibody that is used in various assays within the Life Sciences field. This activated antibody is specifically designed to target transthyretin, an extracellular protein found in human serum. By immobilizing the SMP30 antibody on an electrode, it allows for the detection and quantification of transthyretin levels in samples. Additionally, this antibody has shown inhibitory effects on interferon activity, making it a valuable tool in immunological research and drug development. With its high specificity and sensitivity, the SMP30 antibody offers precise and reliable results for researchers in need of accurate protein analysis.</p>NFATc1 antibody
<p>NFATc1 antibody was raised in mouse using recombinant human NFATc1 (428-716aa) purified from E. coli as the immunogen.</p>ATP5A1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it is highly effective in treating tuberculosis infections. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>
