Produits biochimiques et réactifs

<p>The Cathepsin D antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets Cathepsin D, an enzyme involved in various cellular processes. The antibody is colloidal in nature, allowing for easy and efficient binding to its target. It has been extensively tested and validated for use in research applications such as immunohistochemistry, Western blotting, and ELISA.</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>WNT2B antibody was raised in rabbit using the middle region of WNT2B as the immunogen</p>

<p>RAP1B antibody was raised using the N terminal of RAP1B corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ</p>

<p>The CASR antibody is a glycation-specific monoclonal antibody that is widely used in the field of Life Sciences. It is designed to specifically target and bind to actin filaments, which are essential components of the cytoskeleton. This antibody has been extensively studied and validated for its high specificity and sensitivity in various research applications.</p>

<p>CLASP2 antibody was raised in Rat using alpha-CLASP2-N-terminus and GST fusion protein as the immunogen.</p>

<p>Rabbit polyclonal CEP170 antibody</p>

<p>MAPKAPK5 antibody was raised in Rabbit using Human MAPKAPK5 as the immunogen</p>

<p>CDYL2 antibody was raised using the N terminal of CDYL2 corresponding to a region with amino acids NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG</p>

<p>Methadone antibody is a polyclonal antibody that specifically targets methadone, a synthetic opioid used for pain management and opioid addiction treatment. This antibody binds to methadone molecules, preventing them from binding to opioid receptors in the body. By blocking the effects of methadone, this antibody can help reduce its addictive properties and potential for abuse. Methadone antibody can be used in various life science research applications, including studies on the interaction between opioids and their receptors, as well as investigations into the mechanisms of drug addiction and tolerance. With its high specificity and affinity for methadone, this antibody is a valuable tool for researchers in the field of addiction medicine and pharmacology.</p>

<p>Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK</p>

<p>Rabbit polyclonal PURA antibody</p>

<p>The MPO Monoclonal Antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody targets the myeloperoxidase (MPO) enzyme, which plays a crucial role in various biological processes. It is widely used in research and diagnostics to study and detect MPO expression.</p>

<p>The STX1A antibody is a versatile diagnostic reagent and medicament that belongs to the group of antibodies. It specifically targets β-catenin, a growth factor involved in various cellular processes. The STX1A antibody can be used in research and clinical settings for the detection and quantification of β-catenin levels. It has been shown to exhibit high specificity and sensitivity in antigen-antibody reactions, making it a reliable tool in the field of Life Sciences. The STX1A antibody is available as a monoclonal antibody conjugated with magnetic particles or microparticles, enabling easy separation and purification of target proteins. With its exceptional binding affinity and selectivity, the STX1A antibody is an indispensable tool for studying granulosa cell function and other biological processes.</p>

<p>Rabbit polyclonal CCR5 antibody (Ser336)</p>

<p>Mouse monoclonal Ubiquitin antibody (biotin)</p>

<p>OXER1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug effectively prevents transcription and replication, inhibiting bacterial growth. Its high efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it ensures efficient elimination of mycobacterium strains. With its ability to bind to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibit cell growth in culture, this drug offers a comprehensive solution for tuberculosis treatment.</p>

<p>Mouse monoclonal Peptide YY antibody (Biotin)</p>

<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLI</p>

<p>Rabbit polyclonal ZNF561 antibody</p>

<p>Purified recombinant CXCL2 protein (Mouse) (His tag)</p>

<p>LTA4H antibody was raised in Rabbit using Human LTA4H as the immunogen</p>

<p>Purified Rabbit polyclonal CDYL2 antibody</p>

<p>Rabbit polyclonal MIF antibody (HRP)</p>

<p>The NMT2 antibody is a highly specific monoclonal antibody that is derived from a hybridoma cell line. It targets the chemokine NMT2, a glycoprotein that is activated in certain disease conditions. This antibody has been extensively studied and has shown great potential as a therapeutic agent in various medical applications.</p>

<p>Rabbit polyclonal SPAG6 antibody</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>Purified recombinant ZNRD1 protein (His tag)</p>

<p>The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The UCHL1 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising applications in different areas.</p>

<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG</p>

<p>Purified recombinant MUP1 protein (His tag)</p>

<p>Purified Recombinant Dengue 2 protein</p>

<p>FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA</p>

<p>TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ</p>

<p>Purified recombinant CSDC2 protein (His tag)</p>

<p>Purified recombinant SURF2 protein (His tag)</p>

<p>Purified Polyclonal EEF2K antibody</p>

<p>AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KCNA5 antibody was raised in rabbit using the N terminal of KCNA5 as the immunogen</p>

<p>Rat monoclonal CD45R antibody (PE)</p>

<p>Purified Polyclonal ZADH2 antibody</p>

<p>The SOCS3 antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and specifically targets autoantibodies. The antibody works by inhibiting the glycosylation process and blocking the activity of the phosphatase enzyme. Additionally, it has been shown to effectively neutralize the action of various growth factors.</p>

<p>Rabbit polyclonal STK16 antibody</p>

<p>Purified Polyclonal CIB4 antibody</p>

<p>Rabbit polyclonal MAD1 antibody (Ser428)</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR</p>

<p>Rabbit polyclonal RASSF8 antibody</p>

<p>Rabbit polyclonal TGS1 antibody</p>