Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.574 produits)
- Par Biological Target(100.743 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(454 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
C22ORF28 antibody
C22ORF28 antibody was raised using the N terminal Of C22Orf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGGoat anti Human Kappa Chain (rhodamine)
Goat anti-human kappa chain (Rhodamine) was raised in goat using human kappa light chain as the immunogen.Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (Alk Phos)
Goat anti-rabbit IgG (H+L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.Degré de pureté :Min. 95%MCSF antibody
The MCSF antibody is a monoclonal antibody that targets the chemokine known as Macrophage Colony-Stimulating Factor (MCSF). This antibody has been shown to neutralize the activity of MCSF, which plays a crucial role in the regulation of immune responses and inflammation. By blocking the interaction between MCSF and its receptor, this antibody inhibits the growth and differentiation of macrophages, which are key players in immune responses. Additionally, studies have demonstrated that the MCSF antibody can inhibit the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, and promote the production of anti-inflammatory factors. This makes it a promising therapeutic option for conditions characterized by excessive inflammation, such as autoimmune diseases and certain types of cancer. The MCSF antibody is available in both monoclonal and polyclonal forms, allowing for versatile applications in various research fields including life sciences and molecular docking studies. Its high specificity and affinity make it an invaluable tool for researchers
GLOD4 antibody
GLOD4 antibody was raised in rabbit using the N terminal of GLOD4 as the immunogenDegré de pureté :Min. 95%IGSF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-1671Degré de pureté :Min. 95%ASPA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASPA antibody, catalog no. 70R-3492Degré de pureté :Min. 95%MUC13 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive studies have shown its efficacy through the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.Tau antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. In addition, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.Degré de pureté :Min. 95%BRCA1 antibody
The BRCA1 antibody is a highly specialized monoclonal antibody that specifically targets the BRCA1 protein. This protein plays a crucial role in DNA repair and is associated with the development of breast and ovarian cancers. The BRCA1 antibody has been extensively studied and has shown cytotoxic effects on cancer cells by inhibiting the activity of protein kinases involved in cell proliferation. It binds to the nuclear compartment of cells, specifically targeting the BRCA1 protein, which leads to its degradation and prevents its function in repairing damaged DNA. This antibody has also been used in research to study other proteins, such as alpha-synuclein and collagen, and has shown potential as a therapeutic agent for various types of cancer. With its high specificity and ability to inhibit activated proteins, the BRCA1 antibody is a valuable tool for both diagnostic purposes and targeted therapies.GLS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLS antibody, catalog no. 70R-5477
Degré de pureté :Min. 95%PSMF1 antibody
PSMF1 antibody was raised in rabbit using the middle region of PSMF1 as the immunogenDegré de pureté :Min. 95%RXRA antibody
RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPIIL1 beta antibody
IL1 beta antibody is a highly effective and versatile antibody that targets the IL1 beta protein, a key player in the immune response and inflammation. This monoclonal antibody specifically binds to IL1 beta, neutralizing its activity and preventing its interaction with its receptor. By inhibiting IL1 beta, this antibody can effectively reduce inflammation and promote healing.Actin antibody
Actin antibody was raised in mouse using synthetic NH2 terminus decapeptide of cardiac isoform of actin as the immunogen.CD31 antibody
CD31 antibody was raised in Mouse using a purified recombinant fragment of human CD31 expressed in E. coli as the immunogen.PEX7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PEX7 antibody, catalog no. 70R-3689Degré de pureté :Min. 95%TSHR antibody
TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISRRabbit anti Human IgM (HRP)
Rabbit anti-human IgM (HRP) was raised in rabbit using human IgM Fc5mu fragment as the immunogen.Degré de pureté :Min. 95%Avidin protein (Alk Phos)
Purified Avidin protein (Alk Phos) from hen egg whiteDegré de pureté :Min. 95%PDS5A antibody
PDS5A antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEALRRC57 antibody
LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
DPY19L4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPY19L4 antibody, catalog no. 70R-7039Degré de pureté :Min. 95%Keratin K3 antibody
Keratin K3 antibody was raised in Guinea Pig using synthetic peptide of human keratin K3 coupled to KLH as the immunogen.Degré de pureté :Min. 95%PSTPIP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSTPIP2 antibody, catalog no. 70R-10413Degré de pureté :Min. 95%Neuroplastin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NPTN antibody, catalog no. 70R-1874Degré de pureté :Min. 95%RAD51L1 antibody
RAD51L1 antibody was raised in rabbit using the middle region of RAD51L1 as the immunogen
Degré de pureté :Min. 95%HMOX2 protein
1-264 amino acids: MSAEVETSEG VDESEKKNSG ALEKENQMRM ADLSELLKEG TKEAHDRAEN TQFVKDFLKG NIKKELFKLA TTALYFTYSA LEEEMERNKD HPAFAPLYFP MELHRKEALT KDMEYFFGEN WEEQVQCPKA AQKYVERIHY IGQNEPELLV AHAYTRYMGD LSGGQVLKKV AQRALKLPST GEGTQFYLFE NVDNAQQFKQ LYRARMNALD LNMKTKERIV EEANKAFEYN MQIFNELDQA GSTLARETLE DGFPVHDGKG DMRKDegré de pureté :Min. 95%CD18 antibody (Azide Free)
CD18 antibody (Azide free) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.
OTUB1 antibody
OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTMB for Precipitation
High sensitivity TMB liquid Substrate for Precipitation assaysDegré de pureté :Min. 95%
