Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of CARD17 antibody, catalog no. 70R-10271

The CHK1 antibody is a specific antibody that targets the checkpoint kinase 1 (CHK1) protein. It has been extensively used in life sciences research to study various cellular processes and signaling pathways. The CHK1 protein plays a crucial role in cell cycle regulation, DNA damage response, and cell survival. By inhibiting CHK1, this antibody can help researchers gain insights into the mechanisms of cancer development and identify potential therapeutic targets.

The YB1 antibody is a highly specialized monoclonal antibody that targets the cannabinoid receptor. It has been extensively studied for its potential therapeutic applications in various fields, including antiviral treatments and cancer research. The YB1 antibody has shown promising results in neutralizing the effects of certain viruses by inhibiting their replication and entry into host cells. Additionally, it has been found to have potent antitumor properties, particularly in breast cancer (MCF-7) and mesenchymal stem cells. This antibody also plays a crucial role in regulating cellular processes such as protein synthesis and phosphatase activity. Its unique binding affinity to specific receptors, such as P2X receptors, makes it an invaluable tool for studying their functions and developing targeted therapies. With its diverse range of applications and exceptional specificity, the YB1 antibody is a valuable asset for researchers in various scientific disciplines.

The SUMO1 antibody is a glycoprotein that belongs to the class of lectins. It is a monoclonal antibody that specifically targets SUMO1, a small ubiquitin-like modifier protein. This antibody has been extensively used in research and diagnostics in the field of Life Sciences. The SUMO1 antibody has high specificity and affinity for its target, making it an ideal tool for studying the function and regulation of SUMOylation. It can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Additionally, this antibody has been shown to inhibit protease activity associated with SUMOylation, making it a valuable tool for investigating the role of SUMOylation in cellular processes. With its unique properties and wide range of applications, the SUMO1 antibody is an essential tool for researchers in the field of protein kinase inhibitors and autoantibodies.

ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Purified Rabbit polyclonal OR51F2 antibody

UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

The Ezrin antibody is a colloidal nanocomposite that falls under the category of Life Sciences monoclonal antibodies. It is designed to specifically target and bind to Ezrin, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in research applications related to growth factors, such as insulin and epidermal growth factor. It can be used in immunoassays, western blotting, immunohistochemistry, and other experimental techniques.