Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.574 produits)
- Par Biological Target(100.743 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(454 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
EME1 antibody
EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISCARD17 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CARD17 antibody, catalog no. 70R-10271
Degré de pureté :Min. 95%Peanut Protein Antibody
The Peanut Protein Antibody is a highly versatile and effective product with a wide range of characteristics and applications. It possesses antiviral properties and acts as a growth factor, making it an essential tool in various research fields. This antibody has been extensively studied for its ability to combat infections caused by Mycoplasma genitalium and its potential for inhibiting hemolysis.SMN1 antibody
SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVMIA antibody
MIA antibody was raised in rabbit using highly pure recombinant human MIA as the immunogen.Degré de pureté :Min. 95%DKFZp686E2433 antibody
DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogenDegré de pureté :Min. 95%SERPINA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA3 antibody, catalog no. 70R-5915Degré de pureté :Min. 95%MAF antibody
The MAF antibody is a polyclonal antibody used in Life Sciences. It is designed to target specific proteins and molecules, such as helicobacter, botulinum toxin, β-catenin, epidermal growth factor, and more. This antibody has been extensively tested and proven to be effective in various applications, including Western blotting, immunohistochemistry, and ELISA.XPO1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XPO1 antibody, catalog no. 70R-4738Degré de pureté :Min. 95%NARG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1 antibody, catalog no. 70R-4599Degré de pureté :Min. 95%VARS antibody
VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKMLCHK1 antibody
The CHK1 antibody is a specific antibody that targets the checkpoint kinase 1 (CHK1) protein. It has been extensively used in life sciences research to study various cellular processes and signaling pathways. The CHK1 protein plays a crucial role in cell cycle regulation, DNA damage response, and cell survival. By inhibiting CHK1, this antibody can help researchers gain insights into the mechanisms of cancer development and identify potential therapeutic targets.
ZFP90 antibody
ZFP90 antibody was raised in rabbit using the middle region of ZFP90 as the immunogenDegré de pureté :Min. 95%IGF1 protein
1-115 amino acids: MGPETLCGAE LVDALQFVCG DRGFYFNKPT GYGSSSRRAP QTGIVDECCF RSCDLRRLEM YCAPLKPAKS ADegré de pureté :Min. 95%Goat anti Human κ chain (FITC)
This antibody reacts with kappa light chains on human immunoglobulins.Degré de pureté :Min. 95%YB1 antibody
The YB1 antibody is a highly specialized monoclonal antibody that targets the cannabinoid receptor. It has been extensively studied for its potential therapeutic applications in various fields, including antiviral treatments and cancer research. The YB1 antibody has shown promising results in neutralizing the effects of certain viruses by inhibiting their replication and entry into host cells. Additionally, it has been found to have potent antitumor properties, particularly in breast cancer (MCF-7) and mesenchymal stem cells. This antibody also plays a crucial role in regulating cellular processes such as protein synthesis and phosphatase activity. Its unique binding affinity to specific receptors, such as P2X receptors, makes it an invaluable tool for studying their functions and developing targeted therapies. With its diverse range of applications and exceptional specificity, the YB1 antibody is a valuable asset for researchers in various scientific disciplines.
SUMO1 antibody
The SUMO1 antibody is a glycoprotein that belongs to the class of lectins. It is a monoclonal antibody that specifically targets SUMO1, a small ubiquitin-like modifier protein. This antibody has been extensively used in research and diagnostics in the field of Life Sciences. The SUMO1 antibody has high specificity and affinity for its target, making it an ideal tool for studying the function and regulation of SUMOylation. It can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Additionally, this antibody has been shown to inhibit protease activity associated with SUMOylation, making it a valuable tool for investigating the role of SUMOylation in cellular processes. With its unique properties and wide range of applications, the SUMO1 antibody is an essential tool for researchers in the field of protein kinase inhibitors and autoantibodies.
ST3GAL5 antibody
ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
KLHL12 antibody
KLHL12 antibody was raised in Mouse using a purified recombinant fragment of human KLHL12 expressed in E. coli as the immunogen.TGF beta1 Antibody
The TGF beta1 Antibody is a highly specialized antibody that targets the transforming growth factor beta 1 (TGF-β1), a key protein involved in various biological processes. This antibody has been extensively researched and is widely used in Life Sciences for its ability to neutralize the effects of TGF-β1.Synapsin 1 antibody
The Synapsin 1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to Synapsin 1, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.FAM81A antibody
FAM81A antibody was raised using the N terminal of FAM81A corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTPHC2 antibody
PHC2 antibody was raised in rabbit using the N terminal of PHC2 as the immunogenDegré de pureté :Min. 95%MAGEA8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA8 antibody, catalog no. 70R-3861Degré de pureté :Min. 95%Cyclin B1 antibody
The Cyclin B1 antibody is a highly specific monoclonal antibody that targets the virus surface antigen, influenza hemagglutinin. It is widely used in Life Sciences research to study the role of cyclin B1 in cell cycle regulation and cellular processes. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The Cyclin B1 antibody has been shown to have high affinity and specificity for its target, making it an excellent tool for researchers studying cell division and proliferation. Additionally, this antibody has neutralizing activity against certain strains of influenza virus, making it a potential therapeutic candidate for antiviral treatments. With its exceptional performance and versatility, the Cyclin B1 antibody is a valuable asset in any laboratory setting.UBE2I antibody
UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
Ezrin antibody
The Ezrin antibody is a colloidal nanocomposite that falls under the category of Life Sciences monoclonal antibodies. It is designed to specifically target and bind to Ezrin, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in research applications related to growth factors, such as insulin and epidermal growth factor. It can be used in immunoassays, western blotting, immunohistochemistry, and other experimental techniques.
Degré de pureté :Min. 95%p63 antibody
The p63 antibody is a cytotoxic agent that belongs to the class of antibodies used in Life Sciences. It is activated upon binding to its target antigen and has been shown to be effective in various research applications. The p63 antibody can be used for immunohistochemistry studies to detect the presence and localization of specific proteins or markers in tissue samples. It can also be used as a tool for protein analysis, such as Western blotting or ELISA assays. The p63 antibody has been used in studies involving alpha-fetoprotein, sclerostin, and phosphatase, among others. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific experimental needs. With its high specificity and sensitivity, the p63 antibody is a valuable tool for researchers in the field of Life Sciences.GOPC protein (His tag)
278-454 amino acids: MGSSHHHHHH SSGLVPRGSH MIRKVLLLKE DHEGLGISIT GGKEHGVPIL ISEIHPGQPA DRCGGLHVGD AILAVNGVNL RDTKHKEAVT ILSQQRGEIE FEVVYVAPEV DSDDENVEYE DESGHRYRLY LDELEGGGNP GASCKDTSGE IKVLQGFNKK AVTDTHENGD LGTASETPLD DGASKLDDLH TLYHKKSYDegré de pureté :Min. 95%Rabbit anti Sheep IgG (H + L) (FITC)
Rabbit anti-sheep IgG (H+L) (FITC) was raised in rabbit using sheep IgG whole molecule as the immunogen.Degré de pureté :Min. 95%Protein A/G-Poly-HRP40
Protein A/G-Poly-HRP40 conjugate for use in immunoassaysDegré de pureté :Min. 95%DNTTIP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNTTIP1 antibody, catalog no. 20R-1276Degré de pureté :Min. 95%CXCL10 antibody
The CXCL10 antibody is a highly specialized antibody that has a wide range of applications in the field of Life Sciences. It has been extensively studied for its inhibitory and neutralizing effects on insulin-like growth factor-I (IGF-I) and CXCL13, which are important factors in various biological processes. This antibody has been shown to have anti-angiogenic and anti-fibrotic effects, making it a potential therapeutic option for conditions such as cancer and fibrosis. Additionally, the CXCL10 antibody has been found to have a chemotactic effect on mesenchymal stem cells, further highlighting its versatility in different research areas. This antibody is available as a polyclonal antibody and can be used as a control antibody in various experimental settings.RPS14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPS14 antibody, catalog no. 70R-1393Degré de pureté :Min. 95%
