Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.570 produits)
- Par Biological Target(100.766 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(477 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Influenza A antibody (H3N2) (HRP)
Influenza A antibody (H3N2) (HRP) was raised in goat using Influenza A, strain Texas 1/77 (H3N2) as the immunogen.BHMT antibody
BHMT antibody was raised using the N terminal of BHMT corresponding to a region with amino acids AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
LYN antibody
LYN antibody was raised in Mouse using a purified recombinant fragment of LYN expressed in E. coli as the immunogen.PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Degré de pureté :Min. 95%GSTK1 antibody
GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLCD61 antibody
The CD61 antibody is a highly specialized antibody-drug that belongs to the class of antibodies known as polyclonal antibodies. It is specifically designed to target a specific antigen, known as CD61, which plays a crucial role in various biological processes including chemokine signaling and immune response. This antibody is widely used in research and diagnostic applications such as immunohistochemistry and flow cytometry.
SLC7A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A11 antibody, catalog no. 70R-6800Degré de pureté :Min. 95%CD137L-muCD8 Fusion protein
Purified recombinant Human CD137L-muCD8 Fusion protein
Degré de pureté :Min. 95%SH3BGRL antibody
SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQAMyc antibody
The Myc antibody is a polyclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is commonly used in life sciences research for applications such as immunoassays, immunohistochemistry, and western blotting. This antibody has high affinity and specificity for EGFR, making it an ideal tool for studying the role of this receptor in various biological processes.Degré de pureté :Min. 95%EFCAB3 antibody
EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAOBOX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OBOX6 antibody, catalog no. 20R-1165Degré de pureté :Min. 95%CES6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CES6 antibody, catalog no. 20R-1163Degré de pureté :Min. 95%TARBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TARBP2 antibody, catalog no. 70R-1374
Degré de pureté :Min. 95%TDG antibody
The TDG antibody is a highly specific monoclonal antibody that targets the glycan structures on glycoproteins. It is widely used in life sciences research to study the role of glycans in various biological processes. The TDG antibody can be used for applications such as lectin blotting, glycan profiling, and immunohistochemistry. This antibody recognizes a polymorphic epitope that is activated by fatty acid treatment, making it a valuable tool for studying changes in glycosylation patterns. Additionally, the TDG antibody has been shown to interact with epithelial cadherin, suggesting a potential role in cell adhesion and signaling pathways. With its high specificity and sensitivity, this monoclonal antibody is an essential tool for researchers studying glycan-related processes in human proteins.
Vitamin D antibody
The Vitamin D antibody is an essential tool for immunoassays in the field of Life Sciences. This antibody is specifically designed to bind to Vitamin D and its metabolites, allowing for accurate detection and measurement in various assays. The antibody is highly specific and can be used in a variety of applications, including ELISA, Western blotting, and immunohistochemistry.MLC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MLC1 antibody, catalog no. 70R-5137Degré de pureté :Min. 95%PLEKHB2 antibody
PLEKHB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRESTAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENRabbit anti Mouse Lambda Chain (biotin)
Rabbit anti-mouse lambda chain (biotin) was raised in rabbit using murine lambda light chain as the immunogen.Degré de pureté :Min. 95%SLC10A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC10A4 antibody, catalog no. 70R-6295Degré de pureté :Min. 95%cRAF antibody
The cRAF antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the cRAF protein, a tyrosine kinase receptor involved in various cellular processes such as endothelial growth and collagen synthesis. This antibody can be used to study the role of cRAF in signal transduction pathways and its interaction with other proteins and growth factors. Additionally, the cRAF antibody has been shown to have potential therapeutic applications, including the treatment of autoimmune disorders and certain types of cancer. Its high specificity and affinity make it a valuable tool for researchers studying protein-protein interactions and signaling pathways involving cRAF.VDAC2 antibody
VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNZNF91 antibody
ZNF91 antibody was raised in rabbit using the N terminal of ZNF91 as the immunogenDegré de pureté :Min. 95%IMP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IMP3 antibody, catalog no. 70R-4709Degré de pureté :Min. 95%MIP5 protein
Region of MIP5 protein corresponding to amino acids QFTNDAETEL MMSKLPLENP VVLNSFHFAA DCCTSYISQS IPCSLMKSYF ETSSECSKPG VIFLTKKGRQ VCAKPSGPGV QDCMKKLKPY SI.Degré de pureté :Min. 95%NUP98 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUP98 antibody, catalog no. 70R-5608Degré de pureté :Min. 95%HADH antibody
HADH antibody was raised in rabbit using the middle region of HADH as the immunogenDegré de pureté :Min. 95%AK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AK2 antibody, catalog no. 70R-3439Degré de pureté :Min. 95%SMYD4 antibody
SMYD4 antibody was raised in rabbit using the N terminal of SMYD4 as the immunogenDegré de pureté :Min. 95%Keratin 10 antibody
The Keratin 10 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is a protein-coupled receptor that binds to glutamate and acts as a heparin cofactor. This antibody is commonly used in Life Sciences research, particularly in the study of fetal hemoglobin and its regulation. Additionally, it has been extensively utilized in the field of medicine for the development of targeted therapies and diagnostic tools.
