Produits biochimiques et réactifs

<p>Pf-06412154 hydrochloride is an investigational anti-inflammatory agent, which is synthesized chemically. It functions as a selective inhibitor of Janus kinases (JAK), crucial enzymes involved in the signaling pathways of various cytokines and growth factors. By inhibiting JAK activity, Pf-06412154 disrupts the JAK-STAT pathway, which is implicated in the pathogenesis of several inflammatory and autoimmune disorders. This mode of action is intended to reduce the expression of inflammatory cytokines, offering potential therapeutic benefits.</p>

<p>Anti PTH (1-34) NH₂ is a peptide that inhibits the activity of parathyroid hormone. It is used to study the effects of parathyroid hormone on calcium homeostasis, and as an inhibitor in receptor binding assays. Anti PTH (1-34) NH₂ is purified from rat serum by affinity chromatography with a column containing immobilized antibodies raised against the peptide, followed by ion-exchange chromatography. The peptide has a molecular weight of 2,633.5 Da and the purity is greater than 98%.</p>

<p>RX-104 hydrochloride is a novel, potent, and orally bioavailable anticancer agent that inhibits the synthesis of DNA by exerting its cytotoxic effect on tumor cells. The potential for RX-104 hydrochloride to induce myeloid-derived suppressor cells has been investigated in preclinical models. RX-104 hydrochloride has also demonstrated an ability to activate markers associated with tumor progression in cancer patients. This drug is activated by the enzymes cytochrome P450 3A4 and CYP2C8/9. It also activates markers of resistance to docetaxel, which may be due to the inhibition of myeloid-derived suppressor cells.</p>

<p>RS 17053 hydrochloride is a compound that belongs to the group of non-steroidal anti-inflammatory drugs. It has functional assays as an inhibitor of cyclooxygenase and protein synthesis, with low potency. RS 17053 hydrochloride has been shown to inhibit the production of eicosanoids in rat cardiomyocytes and to induce cardiac hypertrophy in rats. This drug also has blood disorders effects, which may be due to its ability to interfere with protein synthesis or congestive heart failure.</p>

<p>Purified Rabbit polyclonal IL2R beta antibody</p>

<p>Orotirelin is a peptide that is used as a research tool and in the study of protein interactions. Orotirelin binds to orexin receptors, which are found in neurons of the hypothalamus, and activates them. It has been shown to have a potent inhibitory effect on the release of pituitary hormones from the anterior lobe of the pituitary gland. It also acts as an inhibitor for certain ion channels and can be used as an antibody against other ligands that bind to orexin receptors.</p>

<p>Purified recombinant Human MAVS protein (His tag)</p>

<p>Highly selective and potent Tank binding kinase 1 (TBK1) inhibitor</p>

<p>8-Hydroxy carvedilol is an analog of the beta-blocker drug carvedilol that has been shown to have potent anticancer properties. It inhibits the activity of protein kinase C (PKC), which is involved in cell signaling pathways that regulate cell growth and survival. 8-Hydroxy carvedilol has been found to induce apoptosis in human and Chinese hamster ovary cells, as well as in tumor cells from various types of cancer. This drug also inhibits the activity of calcitonin gene-related peptide (CGRP), a neuropeptide that is involved in pain transmission and inflammation. In addition, 8-Hydroxy carvedilol has been shown to inhibit oxytocin-induced contractions in isolated rat uterus tissue. Overall, these findings suggest that 8-Hydroxy carvedilol may have potential as a novel anticancer agent with anti-inflammatory properties.</p>

<p>ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>Rat monoclonal Integrin beta 7 antibody (FITC)</p>

<p>Recombinant Human ATP6V1F protein (His tag)</p>

<p>1-391 amino acids: MGSSHHHHHH SSGLVPRGSH MSGPVPSRAR VYTDVNTHRP REYWDYESHV VEWGNQDDYQ LVRKLGRGKY SEVFEAINIT NNEKVVVKIL KPVKKKKIKR EIKILENLRG GPNIITLADI VKDPVSRTPA LVFEHVNNTD FKQLYQTLTD YDIRFYMYEI LKALDYCHSM GIMHRDVKPH NVMIDHEHRK LRLIDWGLAE FYHPGQEYNV RVASRYFKGP ELLVDYQMYD YSLDMWSLGC MLASMIFRKE PFFHGHDNYD QLVRIAKVLG TEDLYDYIDK YNIELDPRFN DILGRHSRKR WERFVHSENQ HLVSPEALDF LDKLLRYDHQ SRLTAREAME HPYFYTVVKD QARMGSSSMP GGSTPVSSAN MMSGISSVPT PSPLGPLAGS PVIAAANPLG MPVPAAAGAQ Q</p>

<p>The KSP Cadherin antibody is a highly specific antibody that targets the KSP (Kidney-Specific Protein) Cadherin. This transmembrane glycoprotein plays a crucial role in pluripotent stem cell differentiation and development. The antibody has been extensively studied and found to be effective in various applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Purified Polyclonal NEUROD2 antibody</p>

<p>4-Methyltridecane is a root exudate that is found in the tissues of plants. It is synthesized by the plant and has been shown to be involved in plant interactions with fungi, insects, and other plants. 4-Methyltridecane has been shown to have antibacterial properties against Bacillus subtilis and Pseudomonas aeruginosa. It also has anti-inflammatory properties and may be used as an insecticide. 4-Methyltridecane is a precursor for the biosynthesis of glucosinolates, which are compounds that have many functions in plant defense systems.</p>

<p>GSK269962A HCl is a potent and selective inhibitor of Rho-associated coiled-coil containing protein kinase (ROCK), which is derived from synthetic chemical sources. This inhibitor functions by targeting the ATP-binding site of ROCK I and ROCK II isoforms, thereby blocking their kinase activity. The mode of action involves interfering with the phosphorylation of downstream substrates that are crucial for cytoskeletal dynamics. <br><br>GSK269962A HCl is widely used in scientific research to elucidate the roles of ROCK signaling pathways in various cellular processes, including smooth muscle contraction, cell motility, and proliferation. It is invaluable in exploring the therapeutic potential of ROCK inhibition in conditions like hypertension, cancer metastasis, and neurodegenerative diseases. By providing insights into the mechanistic pathways, this inhibitor aids in the understanding of ROCK as a therapeutic target and paves the way for the development of drugs tailored for specific pathologies associated with ROCK dysregulation. Its application in preclinical research contributes significantly to unraveling the complexities of cell signaling and disease mechanisms.</p>

<p>PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP</p>

<p>Mouse monoclonal Cytokeratin AE1+AE3 antibody</p>

<p>MOBKL1B antibody was raised in Rabbit using Human MOBKL1B as the immunogen</p>

<p>Goat anti-mouse IgG (Fab'2) (FITC) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.</p>

<p>OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG</p>

<p>The RLN1 gene encodes a protein that is involved in the regulation of cell growth, differentiation, and apoptosis. It interacts with a number of proteins involved in cancer, tumour progression and metastasis. The function of RLN1 is to interact with other proteins, such as p53 and BRCA2, and regulate their activity. The frequency of this gene has been analysed in healthy controls versus patients with cancer. A number of different tissues have been analysed for this gene including testicular tissue from healthy controls versus patients with testicular cancer. There are also data on the expression levels in normal tissue and cancerous tissue from the same individual. This gene has also been shown to be homologous to other genes that are involved in DNA repair and apoptosis.</p>

<p>p-Hydroxymesocarb is an organic chemical compound, categorized as a pharmacological agent, which is derived from synthetic sources through a series of chemical reactions involving carbamate derivatives. Its mode of action primarily involves interaction with central nervous system receptors, potentially influencing neurochemical pathways by modulating neurotransmitter activity. This compound may mimic or interfere with endogenous neurotransmitters, leading to altered physiological and psychological responses.</p>

<p>AM-9074 is a pyridine compound that acts as a glucokinase activator. It has been shown to increase the activity of this enzyme in vivo, leading to increased glucose uptake and decreased blood glucose levels. AM-9074 is currently under development for the treatment of diabetes mellitus type 2 and may be effective in lowering blood sugar levels in patients with type 1 diabetes.</p>

<p>The CDK2 antibody is a highly effective tool for researchers in the field of life sciences. This monoclonal antibody specifically targets and binds to the activated form of CDK2, a crucial protein involved in cell cycle regulation. By inhibiting the activity of CDK2, this antibody can effectively block cell proliferation and growth.</p>

<p>PBOX-15 is a novel, small molecule that causes mitochondrial membrane depolarization. This leads to the release of cytochrome c and other pro-apoptotic proteins into the cytosol. It also inhibits the BCR-ABL kinase, which is associated with cancer cell proliferation. PBOX-15 has minimal toxicity in animal studies and has been shown to have little effect on drug metabolism. It has been shown to have a potent antiproliferative effect on squamous carcinoma cells and other solid tumours such as breast, prostate, lung, colon, and pancreatic cancers.</p>

<p>The Erythromycin antibody is a polyclonal antibody that specifically targets erythromycin, a macrolide antibiotic used in the treatment of various bacterial infections. This antibody has been extensively tested and shown to have high specificity and affinity for erythromycin. It can be used in various life science applications, including neutralizing erythromycin activity, detecting its presence in samples through immunohistochemistry or Western blotting, and studying its mechanism of action.</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>Anti Motilin (Dog) Serum is a fractionated serum that is a potent inhibitor of motilin. It inhibits motilin-induced contractions in the small intestine and colon. The Anti Motilin (Dog) Serum is supplied as a lyophilized powder containing purified fractions of dog serum, which are produced by fractionation on an ion-exchange column. The product contains high purity antibody and peptides with no detectable endotoxin or other microbial contaminants. The Anti Motilin (Dog) Serum is supplied in a volume of 5 mL and has a CAS number of 46887-37-2.</p>

<p>PDE1C antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rat monoclonal 41BB Ligand antibody (biotin)</p>

<p>TCS 184 is a synthetic glycogen synthase kinase 3 (GSK-3) inhibitor that has been shown to increase the level of glycogen in cultured cells. TCS 184 was also found to inhibit glycogen synthase activity and decrease glucose uptake. The enzyme GSK-3 is involved in the assembly of glycogen, and inhibiting this enzyme leads to increased levels of glycogen. TCS 184 can be used for culturing cells as it does not require oxygen for its synthesis. This drug can be used for short-term studies as it does not have long-term effects on cells. TCS 184 also inhibits GSK-3, which is involved in the regulation of endoderm and extraembryonic tissue development during early embryonic development.</p>

<p>The CYP2C9 antibody is a protein that plays a crucial role in drug metabolism. It is an enzyme involved in the breakdown of various medications, including alkaline phosphatases and glutamate. This antibody is widely used in Life Sciences research to study the interactions between drugs and enzymes.</p>

<p>4-[[3-[4-(4-Carbamimidoylbenzoyl)piperazine-1-carbonyl]-5-nitrophenyl]methyl]piperazine-1-carboximidamide (PPCI) is a potent and selective inhibitor of the NMDAR. PPCI also inhibits the activity of voltage gated potassium channels, alpha7 nicotinic acetylcholine receptors and 5HT3 serotonin receptors. It has been reported to be a promising candidate for the treatment of Alzheimer's disease and other neurological disorders that are characterized by excitotoxicity. PPCI is an important research tool for studies on receptor interactions, ion channels, cell biology, pharmacology, and neuroscience.<br>PPCI was first synthesized in 2006 by scientists from Merck Research Laboratories.br&gt;br&gt;</p>

<p>Purified Polyclonal EMP antibody</p>

<p>Inhibitor of FGFR1 receptor tyrosine kinase</p>

<p>Rabbit polyclonal OR10G2 antibody</p>

<p>KCC 07 is a synthetic peptide that inhibits the VEGF pathway by functioning as an antagonist to VEGF receptors. It has been shown to inhibit tumor growth and improve survival in mice with glioma, a type of brain tumor. KCC 07 also has anti-angiogenic properties and can inhibit the proliferation of endothelial cells. The peptide can be used as an antibody that binds to the extracellular domain of the receptor, preventing binding to VEGF ligand. This inhibition leads to decreased activation of VEGF receptors and decreased cell proliferation.</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>Hydrochlorothiazide-13C,d2 is a research tool that is used to study the interactions between ligands and receptors. It is a 13C,d2 labeled form of hydrochlorothiazide, which has been shown to be an activator of ion channels. Hydrochlorothiazide-13C,d2 was developed using high-purity technology and is available in quantities ranging from 1 mg to 10 g. This product can be used in the study of protein interactions, pharmacology, peptides, and other life science applications.</p>

<p>Rat monoclonal IL28 antibody</p>

<p>MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN</p>

<p>6-[(2R)-4-[7-Chloro-4-(phenylmethyl)-1-phthalazinyl]-2-methyl-1-piperazinyl]-3-pyridinecarbonitrile is a ligand that binds to the GABA receptor and can be used as a research tool for studying the pharmacology of GABA receptors. It is also an inhibitor that has been shown to have high purity and a good solubility in water.</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>P-((4-((1-Oxotetradecyl)amino)phenyl)methyl)-phosphonic acid is a synthetic compound, which is a specialized reagent used primarily in chemical research. It is derived from the modification of phosphonic acid with an aryl amide and a long-chain fatty acid substituent on the phenyl group. This structural configuration imparts the compound with unique physicochemical properties that make it suitable for various scientific studies.</p>

<p>3-Phenyl-1H-quinazoline-2,4-dithione is a cyclic nucleotide phosphodiesterase inhibitor. It inhibits the activity of cyclic nucleotide phosphodiesterases, which are enzymes that break down cyclic nucleotides. Cyclic nucleotides are important in the regulation of cellular processes such as cell growth and differentiation, and 3-phenyl-1H-quinazoline-2,4-dithione has been shown to inhibit these processes. 3-Phenyl-1H-quinazoline-2,4-dithione is used clinically for the treatment of renal injury caused by ischemia reperfusion. It also has been shown to decrease blood pressure and improve blood flow in cases of hypertension. The drug has also been shown to have antiinflammatory properties and can be used for the treatment of inflammatory diseases such as rheumatoid arthritis or Crohn's disease.</p>

<p>Rabbit polyclonal Tyrosine Hydroxylase antibody (Ser31)</p>

<p>The ALF antibody is a neutralizing antibody that targets interferon in Life Sciences. It is a biomolecule that specifically binds to galectin-3, a glycoprotein involved in various biological processes. This monoclonal antibody has been extensively studied and proven to be effective in blocking the activity of galectin-3, making it a valuable tool for research and therapeutic applications. Additionally, the ALF antibody has shown promising results as a potential treatment for multidrug-resistant infections and as a therapeutic agent for diseases involving myelin-associated glycoprotein. With its high specificity and affinity, this monoclonal antibody offers great potential for advancing scientific understanding and developing innovative therapies in the field of Life Sciences.</p>