Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.575 produits)
- Par Biological Target(100.710 produits)
- Par usage/effets pharmacologiques(6.937 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(421 produits)
- Biologie végétale(6.907 produits)
- Métabolites secondaires(14.367 produits)
130493 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Chicken anti Goat IgG (H + L)
Chicken anti Goat IgG (H + L) secondary antibodyDegré de pureté :Min. 95%RPL8 antibody
RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM
MPK3 antibody
The MPK3 antibody is a highly specialized monoclonal antibody that targets the lysis and necrosis factor-related apoptosis-inducing pathways. This antibody is designed to specifically bind to adipose tissue, where it can activate chimeric receptors and trigger apoptosis in targeted cells. In addition to its role in adipose tissue, this antibody has been shown to have nuclear localization and can be used for various applications in life sciences research. It is also commonly used as a tool for studying the functions of vasoactive intestinal peptide (VIP) and catechol-o-methyltransferase (COMT). Whether you are conducting basic research or developing new therapeutic strategies, the MPK3 antibody is an invaluable tool for understanding the intricate mechanisms of cellular signaling and regulation.Rhebl1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Rhebl1 antibody, catalog no. 70R-9197Degré de pureté :Min. 95%RBM12 antibody
RBM12 antibody was raised using the middle region of RBM12 corresponding to a region with amino acids VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMRHuman Pancreas Tissue Lysate
Fresh tissue lysate isolated from human pancreasDegré de pureté :Min. 95%Salmonella typhi Antibody
Salmonella typhi Antibody is a monoclonal antibody that specifically targets Salmonella typhi, the bacteria responsible for causing typhoid fever. This antibody contains specific amino acid residues that bind to antigens present on the surface of Salmonella typhi. It has been shown to be effective in neutralizing the bacteria and preventing its growth and spread.Neuropilin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NETO2 antibody, catalog no. 70R-7286Degré de pureté :Min. 95%ALKBH8 antibody
ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVRNASE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNASE1 antibody, catalog no. 70R-7106Degré de pureté :Min. 95%Fractalkine protein
Region of Fractalkine protein corresponding to amino acids QHHGVTKCNI TCSKMTSKIP VALLIHYQQN QASCGKRAII LETRQHRLFC ADPKEQWVKD AMQHLDRQAA ALTRNG.Degré de pureté :Min. 95%CACYBP antibody
CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKGoat anti Human IgG (H + L) (rhodamine)
Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.SLC7A14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A14 antibody, catalog no. 70R-1797Degré de pureté :Min. 95%PKMYT1 antibody
The PKMYT1 antibody is a mouse monoclonal antibody that is used as a diagnostic agent in the field of Life Sciences. It specifically targets and binds to PKMYT1, a cytosolic protein involved in cell cycle regulation. This antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its high specificity and affinity make it an ideal tool for studying the expression and localization of PKMYT1 in different tissues and cell types. Additionally, this antibody has been shown to have genotoxic effects on pluripotent stem cells, making it a valuable tool for research in regenerative medicine. With its ability to detect activated PKMYT1 and its potential use in diagnosing diseases associated with abnormal cell cycle regulation, this antibody holds great promise in advancing our understanding of various biological processes.CDC25C antibody
The CDC25C antibody is a powerful tool used in Life Sciences research. It is an enzyme substrate that can be used for chromatographic analysis of reactive oxygen species (ROS) and binding proteins. This antibody specifically targets CDC25C, a protein kinase involved in cell cycle regulation. By targeting and inhibiting CDC25C, this antibody can effectively disrupt the cell cycle and inhibit cell division.Degré de pureté :Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to target and bind to the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell death and survival. The BCL2 antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.
WBP4 antibody
WBP4 antibody was raised in rabbit using the N terminal of WBP4 as the immunogenDegré de pureté :Min. 95%Ezrin antibody
The Ezrin antibody is a powerful tool in the field of life sciences. It is a neutralizing antibody that specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. This polyclonal antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.Degré de pureté :Min. 95%TAGLN 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAGLN 3 antibody, catalog no. 70R-9267
Degré de pureté :Min. 95%Transglutaminase 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TGM3 antibody, catalog no. 70R-3925
Degré de pureté :Min. 95%UBE2N Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2N antibody, catalog no. 70R-1157Degré de pureté :Min. 95%POGZ Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POGZ antibody, catalog no. 70R-8313Degré de pureté :Min. 95%Src antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.Abo antibody
Abo antibody was raised in rabbit using the middle region of Abo as the immunogenDegré de pureté :Min. 95%HCN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HCN3 antibody, catalog no. 70R-5168Degré de pureté :Min. 95%Ascc1 antibody
Ascc1 antibody was raised in rabbit using the C terminal of Ascc1 as the immunogen
Degré de pureté :Min. 95%DKC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DKC1 antibody, catalog no. 70R-5644Degré de pureté :Min. 95%Keratin K8 protein
Keratin K8 protein is a vital component of the human hepatocytes and plays a crucial role in various biological processes. It is involved in maintaining the structural integrity of liver cells and regulating gene expression through messenger RNA (mRNA) stabilization. Keratin K8 protein is also known to interact with several cytochrome P450 (CYP) isoforms, which are responsible for metabolizing drugs and other xenobiotics in the liver.Degré de pureté :Min. 95%CST8 antibody
CST8 antibody was raised in rabbit using the N terminal of CST8 as the immunogenDegré de pureté :Min. 95%U2AF2 antibody
U2AF2 antibody was raised using the N terminal of U2AF2 corresponding to a region with amino acids EFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSAS
EIF2C1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2C1 antibody, catalog no. 70R-3471
Degré de pureté :Min. 95%GFAP protein
The GFAP protein is a highly specialized protein that plays a crucial role in various biological processes. It is involved in glutamate metabolism and can be found in human serum. The protein has been extensively studied using techniques such as polymerase chain reaction (PCR) and electrode assays.Degré de pureté :>95% By Sds Gel ElectrophoresisKHDRBS2 antibody
KHDRBS2 antibody was raised in rabbit using the N terminal of KHDRBS2 as the immunogenDegré de pureté :Min. 95%AKAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP1 antibody, catalog no. 70R-5027Degré de pureté :Min. 95%MCP3 protein
Region of MCP3 protein corresponding to amino acids QPVGINTSTT CCYRFINKKI PKQRLESYRR TTSSHCPREA VIFKTKLDKE ICADPTQKWV QDFMKHLDKK TQTPKL.
Degré de pureté :Min. 95%
