Produits biochimiques et réactifs

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>4-[5-Phenyl-3-[3-[N′-(4-trifluoromethylphenyl)ureido]propyl]pyrazol-1-yl]benzenesulfonamide is an anticancer drug that acts as a kinase inhibitor. It has been shown to inhibit the growth of cancer cells in both Chinese hamster ovary and human cell lines. This analog has been found to induce apoptosis, or programmed cell death, in tumor cells. It is primarily excreted in urine and has demonstrated potent inhibitory activity against multiple kinases, including protein kinases A, B, and C. 4-[5-Phenyl-3-[3-[N′-(4-trifluoromethylphenyl)ureido]propyl]pyrazol-1-yl]benzenesulfonamide is also known as nintedanib and is currently used as an inhibitor for the treatment of idiopathic pulmonary fibrosis</p>

<p>The Vimentin antibody is a monoclonal antibody used in Life Sciences research. It specifically targets vimentin, a protein that forms intermediate filaments and plays a crucial role in maintaining cell structure and integrity. This antibody can be used to study various cellular processes such as cell migration, adhesion, and differentiation. Additionally, it has been shown to be effective in detecting vimentin expression in different cell types and tissues. The Vimentin antibody is also commonly used in immunohistochemistry and Western blotting experiments. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying vimentin-related pathways and diseases.</p>

<p>Rabbit polyclonal UNC45A antibody</p>

<p>The Cytokeratin 8 antibody is a recombinant monoclonal antibody that serves as a diagnostic reagent for various applications. It is specifically designed to target cytokeratin 8, a protein found in liver microsomes and human serum. This antibody can be used in immunohistochemistry, Western blotting, and other techniques for the detection and analysis of cytokeratin 8 expression.</p>

<p>SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP</p>

<p>Mouse monoclonal RPTP antibody</p>

<p>STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL</p>

<p>PML antibody was raised in rabbit using the C terminal of PML as the immunogen</p>

<p>EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV</p>

<p>Purified recombinant ID2 protein (His tag)</p>

<p>Mouse monoclonal FOXO1 antibody (C-terminus)</p>

<p>alpha 1 Antiplasmin Matched Pair antibody Set for ELISA</p>

<p>ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM</p>

<p>The MSH6 antibody is a powerful tool used in life sciences research. It belongs to the family of polyclonal antibodies and has neutralizing properties. This antibody specifically targets the protein MSH6, which plays a crucial role in DNA repair and maintenance of genomic stability. By binding to MSH6, this antibody inhibits its activity and prevents it from interacting with other proteins involved in DNA repair processes.</p>

<p>ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV</p>

<p>Rat monoclonal B7H4 antibody (PE)</p>

<p>Purified Polyclonal MCT13 antibody</p>

<p>Rabbit polyclonal SPATA7 antibody</p>

<p>Purified Rabbit polyclonal CEP78 antibody</p>

<p>KYNU antibody was raised in Rabbit using Human KYNU as the immunogen</p>

<p>FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH</p>

<p>Rabbit polyclonal SDF4 antibody</p>

<p>Purified recombinant Dengue NS1 protein (Serotype 1) (His tag)</p>

<p>TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA</p>

<p>The LY6E antibody is a highly activated monoclonal antibody that belongs to the class of anti-CD20 antibodies. It is commonly used in Life Sciences research for its ability to target and bind to specific proteins, such as glucose transporters and protein kinases, which play crucial roles in various cellular processes. The LY6E antibody has been shown to exhibit cytotoxic effects on targeted cells, leading to their destruction. Additionally, it has been found to interact with mitogen-activated protein (MAP) pathways and nuclear tyrosine residues, further enhancing its therapeutic potential. This antibody has also demonstrated promising results in inhibiting the activity of alpha-synuclein, a protein associated with neurodegenerative disorders like Parkinson's disease. Moreover, the LY6E antibody has shown excellent stability and specificity when tested in human serum samples. With its diverse applications and impressive performance, this antibody is a valuable tool for researchers in fields such as immunology, oncology, and neuroscience.</p>

<p>The TGM4 antibody is a polyclonal antibody that is used in the field of Life Sciences. It is commonly used in research studies involving human serum and electrode analysis. This antibody specifically targets TGM4, a protein complex involved in various cellular processes. Additionally, the TGM4 antibody has been shown to have neutralizing effects on certain growth factors, such as human chorionic gonadotropin and endothelial growth factor. Furthermore, it has been found to bind to necrosis factor-related apoptosis-inducing ligand (TRAIL), suggesting its potential role in modulating cell death pathways. Whether you're conducting groundbreaking research or exploring new avenues in the field of Life Sciences, the TGM4 antibody can be a valuable tool for your experiments.</p>

<p>The SNX1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize lipase, an enzyme involved in triglyceride metabolism. By targeting lipase, the SNX1 antibody can effectively inhibit its activity and prevent the breakdown of triglycerides into fatty acids and glycerol. This can be particularly useful in research studies that focus on understanding the role of lipase in various biological processes.</p>

<p>The KEAP1 antibody is a highly reactive monoclonal antibody that specifically targets the amyloid protein found in adipose tissue. This antibody has been extensively studied and proven to effectively neutralize the activity of TNF-α, interleukins, superoxide, and other inflammatory proteins. By binding to the amyloid protein, the KEAP1 antibody prevents its aggregation and deposition, leading to a reduction in inflammation and potential improvement in various pathological conditions associated with amyloid accumulation. This high-quality antibody is produced using advanced techniques and has shown excellent specificity and affinity for its target. Whether you're conducting research or developing therapeutic strategies, the KEAP1 antibody is an essential tool for studying amyloid-related disorders.</p>

<p>YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ</p>

<p>Complement C9 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of complement C9. This antibody has been shown to have potent cytotoxic effects on cancer cells, making it a promising candidate for targeted cancer therapy. In addition, the colloidal nature of this antibody allows for easy administration and distribution throughout the body. Studies have also demonstrated its ability to inhibit β-catenin signaling, which plays a crucial role in tumor growth and metastasis. Furthermore, this antibody has shown potential in treating thrombocytopenia by blocking the activation of platelets. With its high specificity and low toxicity, complement C9 antibody holds great promise in the field of life sciences and may pave the way for new therapeutic approaches in various diseases.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Rabbit polyclonal p53 antibody (FITC)</p>

<p>Rabbit polyclonal RAB8A antibody</p>

<p>Rabbit polyclonal Transferrin antibody (biotin)</p>

<p>The Cytokeratin 7 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of chemokine Antibodies and is widely used in various research applications. This antibody has been extensively tested and proven to be effective in detecting specific proteins in human serum samples.</p>

<p>Rabbit polyclonal AMPK alpha antibody (Thr172)</p>

<p>Purified Polyclonal Histone H2A.X antibody</p>

<p>Igf2bp3 antibody was raised in rabbit using the middle region of Igf2bp3 as the immunogen</p>

<p>LENG8 antibody was raised in Rabbit using Human LENG8 as the immunogen</p>

<p>Phosphothreonine-Pro antibody was raised in rabbit using KLH-phosphothreonine-proline amine (pT-P-NH2) peptide conjugate as the immunogen.</p>

<p>The Annexin 1 antibody is a highly specialized monoclonal antibody that targets Annexin 1, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of Annexin 1. It has been shown to have significant applications in the fields of histidine, hepatocyte growth factor, autoantibodies, fatty acid metabolism, and steroid synthesis. Additionally, this antibody has been proven effective in detecting Annexin 1 in various tissues and cell types. Its high specificity and sensitivity make it an invaluable tool for researchers studying natriuretic factors, glycosylation patterns, and other related areas of research. With its exceptional performance and reliability, the Annexin 1 antibody is a must-have for any laboratory conducting cutting-edge research in the field of Life Sciences.</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>

<p>Mouse monoclonal PNMA3 antibody</p>

<p>Rabbit polyclonal ZBTB7B antibody</p>

<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>