Produits biochimiques et réactifs

Rabbit polyclonal RAR alpha antibody (Ser77)

RBMS3 antibody was raised using the N terminal of RBMS3 corresponding to a region with amino acids GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA

Rat monoclonal IgA antibody (PE)

Rabbit polyclonal PLAGL2 antibody

GCHFR antibody was raised in Rabbit using Human GCHFR as the immunogen

WBP2NL antibody was raised using the middle region of WBP2NL corresponding to a region with amino acids GYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLP

Purified Polyclonal TIF1 alpha antibody

Mouse monoclonal UbK63 antibody

The Bcr antibody is a highly specialized Polyclonal Antibody that targets the growth factor VEGF (vascular endothelial growth factor). It is designed to specifically bind to the activated form of this antigen, inhibiting its function and preventing angiogenesis. This antibody has been extensively studied and proven to have potent anti-VEGF activity, making it an ideal therapeutic option for conditions such as cancer and age-related macular degeneration.

B4GALT3 antibody was raised in Rabbit using Human B4GALT3 as the immunogen

The CREB antibody is a highly specific and sensitive tool used in Life Sciences research. It is an antibody that specifically targets the CREB protein, which plays a crucial role in gene expression and transcription regulation. This antibody has been extensively validated and can be used in various applications, including immunohistochemistry, western blotting, and chromatin immunoprecipitation assays.

The ID3 antibody is an activated antiviral protein kinase that plays a crucial role in various biological processes. It has been extensively studied using mass spectrometric methods and has shown to have 3-kinase activity. The ID3 antibody has been found to regulate the expression of c-myc, a proto-oncogene involved in cell proliferation and apoptosis. In Life Sciences, this antibody is widely used for its neutralizing properties against specific targets. Monoclonal antibodies like the ID3 antibody are highly specific and can be used for various applications, including immunoprecipitation, Western blotting, and immunohistochemistry. They have also been used in mass spectrometric analyses of human serum proteins, such as fibrinogen and interferon. With its high affinity and specificity, the ID3 antibody is a valuable tool for researchers in the field of Life Sciences.

CBX3 antibody was raised in rabbit using the middle region of CBX3 as the immunogen

The NNMT antibody is a monoclonal antibody that targets and neutralizes the epidermal growth factor-like growth factor. This antibody has been shown to effectively inhibit the activity of this growth factor, which plays a crucial role in various cellular processes. The NNMT antibody can be used in research settings to study the function and regulation of this growth factor, as well as its potential therapeutic applications. Additionally, this antibody can be used in diagnostic assays to detect and quantify the levels of this growth factor in human serum or other biological samples. With its high specificity and potency, the NNMT antibody is a valuable tool for researchers and clinicians alike.

A synthetic peptide for use as a blocking control in assays to test for specificity of EFCAB3 antibody, catalog no. 70R-4544

PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY

IgG antibody was raised in Mouse using A fusion protein containing human IgG Fc as the immunogen.

Rabbit polyclonal PRKX antibody

CD45 antibody was raised in mouse using human CD45 as the immunogen.

The PLCG2 antibody is a highly specialized tool used in the field of Life Sciences. It plays a crucial role in various cellular processes by acting as an electrode that activates phosphatase and protein kinase signaling pathways. This antibody is specifically designed to target PLCG2, a key enzyme involved in signal transduction.

Rabbit polyclonal C21orf33 antibody

The Cdc27 Antibody is a highly specialized product in the field of Life Sciences. It is a Monoclonal Antibody that targets TNF-α, interferon, and anti-DNP antibodies. This antibody has the ability to induce lysis and neutralize globulin. Additionally, it has antiangiogenic properties and inhibits endothelial growth factor. The Cdc27 Antibody is also cytotoxic and can activate caspase-9, which plays a crucial role in apoptosis. With its wide range of applications and potent effects, this antibody is an essential tool for researchers in various fields of study.

FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE

Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) fragment as the immunogen.

RNF31 antibody was raised using the middle region of RNF31 corresponding to a region with amino acids SLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKL

The TMEFF2 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for research purposes. This antibody specifically targets TMEFF2, which is an antigen involved in various biological processes.

Purified recombinant CPPED1 protein (His tag)

Rat monoclonal IgG2b Isotype Control Fc fusion protein (allophycocyanin)

POLR1D antibody was raised in mouse using recombinant Human Polymerase (Rna) I Polypeptide D, 16Kda (Polr1D)

Rabbit polyclonal TOP3A antibody

Mouse monoclonal NLN antibody

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a central role in various cellular processes. It's a key player in the PI3K/Akt/mTOR pathway, which is essential for regulating cell growth, survival, metabolism, and proliferation.Structure: Akt has three main isoforms in humans (Akt1, Akt2, and Akt3), each encoded by different genes. Activation: Akt activation is typically initiated by external signals, such as growth factors or insulin, that bind to cell surface receptors. This activates phosphoinositide 3-kinase (PI3K), which then produces phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane. PIP3 then recruits Akt to the membrane where it is activated by two key phosphorylation events at Thr308 and Ser473. Once fully activated, Akt can move to different parts of the cell to phosphorylate its target proteins.The key functions of Akt include:Cell Survival and Anti-Apoptosis: Akt inhibits apoptosis by phosphorylating and inactivating several pro-apoptotic proteins, such as BAD and Caspase-9.Cell Growth and Proliferation: By promoting protein synthesis and inhibiting pathways that would otherwise halt the cell cycle, Akt encourages cell growth. It activates mTOR, a major regulator of protein synthesis and cellular growth.Metabolic Regulation: Akt influences metabolism by increasing glucose uptake and glycolysis, primarily through GLUT4 translocation and hexokinase activation, which is especially important in muscle and adipose tissues.Angiogenesis: Akt can stimulate the growth of new blood vessels by increasing the expression of VEGF (vascular endothelial growth factor), supporting tissue growth and repair.Cell Migration and Invasion: Akt is involved in processes that facilitate cell motility, aiding in wound healing and, unfortunately, in the spread of cancer cells.Given its role in promoting cell survival and growth, Akt is frequently hyperactivated in cancers, leading to uncontrolled cell division and tumor growth. Many cancer therapies target the PI3K/Akt/mTOR pathway to suppress this hyperactivity. Furthermore Akt's role in regulating glucose metabolism links it to insulin signaling. Defects in this pathway can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.

LOC729185 antibody was raised using the N terminal Of Loc729185 corresponding to a region with amino acids VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG

MOMA2 antibody (mouse) was raised in rat using mouse lymph node stroma as the immunogen.

Rabbit polyclonal RAPGEF5 antibody

FAU antibody was raised in Rabbit using Human FAU as the immunogen

The TOM20 antibody is a highly specific monoclonal antibody that targets the TOM20 protein. This protein is an essential component of the translocase of the outer mitochondrial membrane (TOM) complex, which is involved in the import of proteins into mitochondria. The TOM20 antibody has been widely used in research and diagnostic applications in the field of Life Sciences.

A synthetic peptide for use as a blocking control in assays to test for specificity of LCA5 antibody, catalog no. 70R-3735

Purified Polyclonal CD49e LC antibody

CD36 antibody was raised in Rabbit using Human CD36 as the immunogen

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

A synthetic peptide for use as a blocking control in assays to test for specificity of CTDSPL antibody, catalog no. 70R-2916

Cytokeratin 5 antibody is a monoclonal antibody that specifically targets the Cytokeratin 5 protein. This protein is found in various tissues and is commonly used as a marker for epithelial cells. The antibody recognizes specific epitopes on the Cytokeratin 5 protein, allowing for its detection and localization in samples.