Produits biochimiques et réactifs

<p>Rabbit polyclonal CPNE9 antibody</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>Rabbit polyclonal TPK1 antibody</p>

<p>Purified Rabbit polyclonal BRWD3 antibody</p>

<p>Rabbit polyclonal Rhombotin 1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM16 antibody, catalog no. 70R-6445</p>

<p>TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS</p>

<p>The MRGPRX4 antibody specifically targets the Mas-related G protein-coupled receptor X4 (MRGPRX4), a GPCR encoded by the MRGPRX4 gene. This receptor is primarily expressed in human tissues, including sensory neurons and skin keratinocytes. Functionally, the activation of the receptor by specific ligands can trigger itch sensations, and it may also play a role in nociception. Researchers commonly use MRGPRX4 antibodies for techniques such as immunohistochemistry (IHC), Western blot (WB), and immunocytochemistry (ICC/IF) to study their expression and localization. Notably, these antibodies have undergone rigorous validation to ensure specificity. Furthermore, recent research highlights the role of MRGPRX4 in cholestatic itch, where bile acids act as natural ligands for this receptor. These findings provide a promising new drug target for anti-itch therapies.</p>

<p>Rabbit polyclonal PMF1 antibody</p>

<p>The CDK2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and bind to cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. This antibody has been extensively validated for use in various assays, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA</p>

<p>LEC antibody was raised in mouse using highly pure recombinant human LEC as the immunogen.</p>

<p>Rabbit polyclonal TNNC1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OTUD6A antibody, catalog no. 70R-9721</p>

<p>ARHGAP1 antibody was raised in Rabbit using Human ARHGAP1 as the immunogen</p>

<p>Neuroserpin antibody was raised in rabbit using highly pure recombinant human neuroserpin as the immunogen.</p>

<p>Tobramycin Conjugate for use in immunoassays</p>

<p>Mouse monoclonal ACOT12 antibody</p>

<p>Purified recombinant Human Tau protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFSD antibody, catalog no. 70R-4964</p>

<p>Mouse monoclonal Calcineurin alpha antibody</p>

<p>MRAP antibody was raised in Rabbit using Human MRAP as the immunogen</p>

<p>IL22RA1 antibody was raised in Rabbit using Human IL22RA1 as the immunogen</p>

<p>Region of TWEAK protein corresponding to amino acids EQAPGTAPCS RGSSWSADLD KCMDCASCRA RPHSDFCLGC AAAPPAPFRL LWP.</p>

<p>Rabbit polyclonal PTDSS1 antibody (FITC)</p>

<p>CRTC1 antibody was raised in Mouse using a purified recombinant fragment of human CRTC1 expressed in E. coli as the immunogen.</p>

<p>FLJ30934 antibody was raised in rabbit using the middle region of FLJ30934 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BOLL antibody, catalog no. 70R-4749</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHCHD3 antibody, catalog no. 70R-4355</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>The PDK1 antibody is a monoclonal antibody that targets the growth factor receptor PDK1. It specifically binds to the antigen expressed on the surface of cells and inhibits the activation of PDK1, which plays a crucial role in cell growth and survival. This antibody has been shown to block the binding of vitronectin, glucagon, galactose, and chemokines to PDK1, thereby preventing downstream signaling pathways associated with cell proliferation. The PDK1 antibody is a potent family kinase inhibitor that can be used in research studies to investigate the role of PDK1 in various cellular processes. It has also shown promising results in preclinical studies as a potential therapeutic target for diseases such as cancer. Additionally, this antibody can be used in combination with other targeted therapies, such as cetuximab or epidermal growth factor receptor (EGFR) inhibitors, to enhance their efficacy. The PDK1 antibody is available as a high-quality monoclonal antibody</p>

<p>PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM16C antibody, catalog no. 70R-6548</p>

<p>GDI2 antibody was raised in Rabbit using Human GDI2 as the immunogen</p>

<p>FRK antibody was raised in Rabbit using Human FRK as the immunogen</p>

<p>PIK3IP1 antibody was raised using the middle region of PIK3IP1 corresponding to a region with amino acids QALPAFTTEIQEASEGPGADEVQVFAPANALPARSEAAAVQPVIGISQRV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-4732</p>

<p>The CD18 antibody is a monoclonal antibody that targets endothelial growth and erythropoietin. It specifically binds to low density lipoprotein (LDL) receptors on the surface of cells, inhibiting their uptake of LDL cholesterol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal IRS1 antibody (Ser307)</p>

<p>Mouse PMN antibody was raised in rabbit using mouse PMNs as the immunogen.</p>

<p>The IL6 antibody is a powerful cytotoxic agent that targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various diseases. This monoclonal antibody specifically binds to IL-6, neutralizing its activity and preventing its interaction with cell surface receptors. By blocking the IL-6 signaling pathway, this antibody inhibits the production of other inflammatory mediators such as tumor necrosis factor-alpha (TNF-α) and interferons.</p>

<p>Methadone p Conjugate for use in immunoassays</p>

<p>SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY</p>

<p>Purified Polyclonal CK1 gamma 2 antibody</p>

<p>GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR</p>

<p>HIV1 antibody (HTLV3) (HRP) was raised in goat using human isolate as the immunogen.</p>

<p>The EEN antibody is a glycoprotein that has cytotoxic properties and is known for its anti-glial fibrillary acidic protein (GFAP) activity. It belongs to the family of antibodies that target specific proteins involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to adipocytes, endothelial growth factors, and fatty acid metabolism. The EEN antibody is widely used in scientific studies and experiments to investigate the role of GFAP and its potential therapeutic applications. It is available as polyclonal antibodies, ensuring high specificity and sensitivity for accurate detection and analysis.</p>

<p>ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV</p>

<p>RGS16 antibody is a monoclonal antibody that specifically targets and inhibits the activity of RGS16 protein. RGS16 is involved in various cellular processes, including growth factor signaling, apoptosis, and immune response. By binding to RGS16, this antibody prevents its activation and cytotoxic effects. It also interferes with the formation of RGS16 dimers, which are necessary for its function. This monoclonal antibody has been shown to be effective in inhibiting the growth of Mycoplasma genitalium, a bacterium associated with various reproductive disorders. Additionally, it has potential therapeutic applications in autoimmune diseases where autoantibodies target RGS16 or its interacting proteins. The use of this antibody may provide insights into the role of RGS16 in different cellular pathways and contribute to the development of novel treatments.</p>

<p>Rabbit anti-dog IgG (biotin) was raised in rabbit using canine IgG F(c) fragment as the immunogen.</p>