Produits biochimiques et réactifs

<p>The Peanut Protein Antibody is a polyclonal antibody that specifically targets peanut proteins. It can be used in various life science applications to detect and quantify the presence of peanut proteins in samples. This antibody has been shown to have a high affinity for dopamine, interleukin-6, oncostatin, protein kinase, leukemia inhibitory factor, and other related molecules. It works by binding to these target proteins and forming an antigen-antibody complex, which can be detected using various techniques such as immunohistochemistry or Western blotting. Additionally, this antibody has been demonstrated to inhibit the activity of certain enzymes and signaling pathways involved in cellular processes. Its colloidal properties allow for easy conjugation with other molecules or particles for specific applications. Overall, the Peanut Protein Antibody is a valuable tool for researchers studying peanut allergies, food safety, and related fields.</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>AOC3 antibody was raised in Rabbit using Human AOC3 as the immunogen</p>

<p>GMEB1 antibody was raised in rabbit using the N terminal of GMEB1 as the immunogen</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HINT1 antibody, catalog no. 70R-4222</p>

<p>SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL</p>

<p>Purified Polyclonal Neuregulin SMDF antibody</p>

<p>Recombinant human CHMP4A protein (His tag)</p>

<p>RASGEF1C antibody was raised using the middle region of RASGEF1C corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE</p>

<p>The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.</p>

<p>PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS</p>

<p>MPP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL</p>

<p>SSX2IP antibody was raised using the middle region of SSX2IP corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA</p>

<p>Mouse monoclonal SulT1A1 antibody</p>

<p>The IL4 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the erythropoietin receptor, which plays a crucial role in cell growth and development. This antibody has been extensively studied and proven to have high affinity and specificity for its target.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Dusp11 antibody, catalog no. 70R-8479</p>

<p>Purified Polyclonal mGLUR4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK1 antibody, catalog no. 70R-5220</p>

<p>ZNF641 antibody was raised in rabbit using the middle region of ZNF641 as the immunogen</p>

<p>1-335 amino acids: MGKVKVGVNG FGRIGRLVTR AAFNSGKVDI VAINDPFIDL NYMVYMFQYD STHGKFHGTV KAENGKLVIN GNPITIFQER DPSKIKWGDA GAEYVVESTG VFTTMEKAGA HLQGGAKRVI ISAPSADAPM FVMGVNHEKY DNSLKIISNA SCTTNCLAPL AKVIHDNFGI VEGLMTTVHA ITATQKTVDG PSGKLWRDGR GALQNIIPAS TGAAKAVGKV IPELNGKLTG MAFRVPTANV SVVDLTCRLE KPAKYDDIKK VVKQASEGPL KGILGYTEHQ VVSSDFNSDT HSSTFDAGAG IALNDHFVKL ISWYDNEFGY SNRVVDLMAH MASKE</p>

<p>Purified Polyclonal RAB33A antibody</p>

<p>GSK3 beta protein is a target molecule in the field of Life Sciences. It belongs to the family of lectins, which are proteins that bind to specific carbohydrates. GSK3 beta protein has been studied extensively for its role in various biological processes, including cell signaling and regulation of gene expression. It has been shown to interact with a wide range of proteins and antigens, including interferon and metal-binding proteins.</p>

<p>CXCL14 antibody was raised in rabbit using the middle region of CXCL14 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC7 antibody, catalog no. 70R-1337</p>

<p>Rabbit polyclonal SENP7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VDR antibody, catalog no. 70R-1930</p>

<p>Purified Polyclonal DIO3 antibody</p>

<p>cAMP Conjugate for use in immunoassays</p>

<p>BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA</p>

<p>SLC12A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3A antibody, catalog no. 70R-2159</p>

<p>Purified recombinant Human DIRAS1 protein</p>

<p>Rabbit Polyclonal MAPKAPK2 antibody (Thr334)</p>

<p>The PNMT antibody is a highly specific monoclonal antibody that targets the phenylethanolamine N-methyltransferase (PNMT) enzyme. This enzyme is responsible for the conversion of norepinephrine to epinephrine, a process that plays a crucial role in various physiological functions. The PNMT antibody has been extensively studied and validated for its use in research and diagnostic applications.</p>

<p>Purified recombinant RPL5 protein (His tag)</p>

<p>GIMAP7 antibody was raised in Rabbit using Human GIMAP7 as the immunogen</p>

<p>ALDH9A1 antibody was raised in rabbit using the C terminal of ALDH9A1 as the immunogen</p>

<p>ANGPTL2 antibody was raised in Rabbit using Human ANGPTL2 as the immunogen</p>

<p>Ercc1 antibody was raised in rabbit using the C terminal of Ercc1 as the immunogen</p>

<p>The CDC42 antibody is a highly specific monoclonal antibody that is used in bioassays to detect and analyze the presence of CDC42, an important oncogene homolog. This antibody is designed to target the CDC42 protein, which plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. The CDC42 antibody has been extensively tested and validated for its specificity and sensitivity in detecting CDC42 in human serum samples. It can be used in research studies investigating the involvement of CDC42 in cancer development and progression. Additionally, this antibody has shown potential as a diagnostic tool for detecting elevated levels of CDC42 in certain types of cancer, such as alpha-fetoprotein-positive hepatocellular carcinoma. Its high affinity and selectivity make it a valuable tool for researchers studying signal transduction pathways involving CDC42 or investigating therapeutic targets related to this protein.</p>

<p>Mouse monoclonal SERPINB4 antibody</p>

<p>Purified  Type 6 Adenovirus protein</p>

<p>Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.</p>

<p>The MAP2 antibody is a polyclonal antibody that specifically targets the protein MAP2. This protein plays a crucial role in various cellular processes, including neuronal development and maintenance. The MAP2 antibody has been extensively studied in the field of life sciences and has shown great potential for research purposes.</p>

<p>Hexestrol p-OH Conjugate for use in immunoassays</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Affinity purified Rabbit polyclonal TR alpha antibody</p>

<p>PSME1 antibody was raised using the middle region of PSME1 corresponding to a region with amino acids KEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEI</p>

<p>Rabbit polyclonal Peroxiredoxin 1 antibody (FITC)</p>