Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.572 produits)
- Par Biological Target(100.755 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(467 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
Dysferlin antibody
The Dysferlin antibody is a polyclonal antibody that specifically targets the fibrinogen molecule. It is commonly used in Life Sciences research to study the activation of fibrinogen and its role in various biological processes. This antibody can be utilized in experiments involving electrodes, insulin, and other molecules or drugs. Additionally, it has been shown to have an impact on endogenous hematopoietic cells and endothelial growth factors. The Dysferlin antibody has also demonstrated anticoagulant properties when tested with human serum. Its versatility makes it an essential tool for researchers studying growth factors, fatty acids, and other related areas of study.ZFP589 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP589 antibody, catalog no. 20R-1179
Degré de pureté :Min. 95%Rabbit anti Human IgG (H + L) (Alk Phos)
Rabbit anti-human IgG (H+L) (Alk Phos) was raised in rabbit using human IgG whole molecule as the immunogen.Degré de pureté :Min. 95%Bnip3l antibody
Bnip3l antibody was raised in rabbit using the middle region of Bnip3l as the immunogenDegré de pureté :Min. 95%MLKL antibody
The MLKL antibody is a highly specialized product in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody has been extensively studied for its neuroprotective properties and has shown promising results in various research studies.
Factor VIII antibody
Factor VIII antibody was raised in sheep using Recombinant canine Factor VIII as the immunogen.Degré de pureté :Min. 95%PPIH antibody
PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGMYBPH antibody
MYBPH antibody was raised in rabbit using the middle region of MYBPH as the immunogenDegré de pureté :Min. 95%SLC41A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC41A3 antibody, catalog no. 70R-6669
Degré de pureté :Min. 95%SEK1 antibody
The SEK1 antibody is a monoclonal antibody that specifically targets lipoprotein lipase. It is commonly used in research and diagnostic applications to detect and quantify the levels of lipoprotein lipase in various biological samples. Lipoprotein lipase plays a crucial role in lipid metabolism, as it hydrolyzes triglycerides from circulating lipoproteins, allowing the release of free fatty acids for energy production or storage. This antibody can also be used to study other proteins involved in lipid metabolism, such as growth hormone receptor, collagen, tyrosine kinase receptor, and phosphatase. With its high specificity and sensitivity, the SEK1 antibody is an invaluable tool for researchers and clinicians working in the field of lipid biology and related disorders.
Degré de pureté :Min. 95%C15ORF24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C15orf24 antibody, catalog no. 70R-7428Degré de pureté :Min. 95%DNAJC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJC2 antibody, catalog no. 70R-9915Degré de pureté :Min. 95%CASP3 antibody
CASP3 antibody was raised in rabbit using the N terminal of CASP3 as the immunogen
Degré de pureté :Min. 95%PAK1 antibody
The PAK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the PAK1 protein, which plays a crucial role in various cellular processes such as chemokine signaling, endothelial growth, and cell migration. This antibody is widely used in studies investigating the mechanisms of cell growth and development.Degré de pureté :Min. 95%Smad4 antibody
The Smad4 antibody is a highly specialized polyclonal antibody that has been developed for use in various life science applications. This antibody specifically targets Smad4, a protein that plays a crucial role in the regulation of cell growth and differentiation. It has been shown to inhibit endothelial and keratinocyte growth, making it an essential tool for researchers studying these processes.FAK antibody
The FAK antibody is a hormone peptide that is used to detect and target specific antigens in the body. It is a monoclonal antibody that specifically binds to alpha-fetoprotein (AFP), a protein that is often elevated in certain types of cancer. The FAK antibody works by binding to tyrosine residues on AFP, which activates signaling pathways that can inhibit cell growth and promote apoptosis. This antibody is commonly used in life sciences research to study the role of AFP in various cellular processes. Additionally, it has been shown to be effective in targeting other antigens such as c-myc and fatty acid-activated receptors. With its high specificity and versatility, the FAK antibody is an essential tool for researchers and scientists working in the field of molecular biology and immunology.Claudin 5 antibody
The Claudin 5 antibody is a trifunctional polyclonal antibody that is widely used in Life Sciences research. It has neutralizing properties and can be used as a monoclonal antibody to target specific proteins or molecules of interest. This antibody is commonly used in experiments involving the immobilization of target proteins on an electrode surface for further analysis. It has been shown to inhibit the activity of transforming growth factor-beta (TGF-beta) and other growth factors, making it a valuable tool in studying cell signaling pathways. Additionally, the Claudin 5 antibody can be conjugated with streptavidin or transferrin to facilitate specific binding to target cells or tissues. Its versatility and wide range of applications make it an essential component in many research studies involving hepatocyte growth, mesenchymal stem cells, and other cellular processes.CD3 antibody (Spectral Red)
CD3 antibody (Spectral Red) was raised in mouse using chicken CD3 as the immunoge.
ITIH1 antibody
ITIH1 antibody was raised in rabbit using the C terminal of ITIH1 as the immunogenDegré de pureté :Min. 95%PON1 antibody
The PON1 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and bind to brain natriuretic peptide (BNP), a biomolecule involved in various physiological processes. With its high specificity and affinity, the PON1 antibody enables researchers to accurately detect and measure BNP levels in biological samples....Apelin Receptor antibody
The Apelin Receptor antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the apelin receptor, a protein involved in various physiological processes such as hyaluronic acid synthesis and adipose tissue formation. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting the apelin receptor in various samples.
One of the key applications of the Apelin Receptor antibody is its use in studying the role of the apelin receptor in disease pathways. Researchers can utilize this antibody to investigate the presence and distribution of the apelin receptor in different tissues and cell types. This information can help uncover potential therapeutic targets or biomarkers for conditions related to adipose tissue dysfunction or hyaluronic acid metabolism.
Furthermore, the Apelin Receptor antibody has been employed in assays aimed at understanding autoimmune disorders. It has demonstrated its ability to detect autoantibodies targeting the apelin receptor in human serum samples. These findings can contribute toCNP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CNP antibody, catalog no. 70R-2044
Degré de pureté :Min. 95%Estrogen Receptor alpha antibody (Ser118)
Rabbit polyclonal Estrogen Receptor alpha antibody (Ser118)AKR7A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AKR7A3 antibody, catalog no. 70R-4223Degré de pureté :Min. 95%HSP90 antibody
The HSP90 antibody is a multidrug, pegylated antibody that has shown promising results in the field of Life Sciences. It has been extensively studied for its ability to inhibit the glycation process and has been found to be effective in reducing the formation of advanced glycation end products (AGEs). This antibody also demonstrates strong binding affinity to specific markers, such as alpha-fetoprotein, collagen, and actin filaments. It can be used in various applications, including enzyme-linked immunosorbent assays (ELISAs), Western blotting, and immunohistochemistry. The HSP90 antibody is available in both monoclonal and polyclonal forms, providing researchers with options depending on their specific needs. With its high specificity and reliability, this antibody is an essential tool for studying protein-protein interactions and cellular processes in the field of Life Sciences.
TRKA antibody
TRKA antibody was raised in Mouse using purified recombinant extracellular fragment of human TrkA(aa33-423) fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.STIM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STIM1 antibody, catalog no. 70R-6770Degré de pureté :Min. 95%NBEAL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NBEAL1 antibody, catalog no. 70R-4615
Degré de pureté :Min. 95%ApoBEC2 antibody
ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNMCP2 protein (Mouse)
Region of MCP2 protein corresponding to amino acids GPDKAPVTCC FHVLKLKIPL RVLKSYERIN NIQCPMEAVV FQTKQGMSLC VDPTQKWVSE YMEILDQKSQ ILQP.Degré de pureté :Min. 95%FILIP1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FILIP1L antibody, catalog no. 70R-2730Degré de pureté :Min. 95%ATF2 antibody
The ATF2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets ATF2, a transcription factor that plays a crucial role in regulating gene expression. This antibody has been shown to have neutralizing effects on ATF2, inhibiting its activity and preventing it from binding to DNA. Additionally, the ATF2 antibody has been found to have therapeutic potential in the treatment of various diseases, including cancer and autoimmune disorders. It has been shown to inhibit the growth of collagen-producing cells and suppress the production of multidrug resistance proteins. Furthermore, studies have demonstrated that the ATF2 antibody can block the activity of alpha-fetoprotein and urokinase plasminogen activator, both of which are involved in tumor progression and metastasis. This monoclonal antibody has also been found to modulate tyrosine kinase signaling pathways and inhibit the growth factor-induced cell proliferation. In addition to its therapeutic applications, the ATF2 antibody is widely used as a research tool for studyingDegré de pureté :Min. 95%EMR1 antibody
The EMR1 antibody is a powerful tool used in protein-protein interactions research. It is an autoantibody that specifically targets the EMR1 protein, making it ideal for studying its function and role in various biological processes. This monoclonal antibody has been extensively tested and validated for its specificity and high affinity to the target protein.NAP1 antibody
The NAP1 antibody is a polyclonal antibody that specifically targets acid residues in various proteins. It is widely used in the field of Life Sciences for research purposes. This antibody has been shown to bind to dopamine, heparin cofactor, fetal hemoglobin, and other proteins of interest. NAP1 antibodies are commonly used as inhibitors or activators in various assays and experiments. Additionally, they have been utilized in studies involving pluripotent stem cells and collagen. With their high specificity and affinity, NAP1 antibodies are valuable tools for researchers in the field of Life Sciences.
IgG2a Isotype Control Fc fusion protein
Rat monoclonal IgG2a Isotype Control Fc fusion protein
Degré de pureté :Min. 95%SLC46A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC46A1 antibody, catalog no. 70R-6536Degré de pureté :Min. 95%
