Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.570 produits)
- Par Biological Target(100.766 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(477 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
C1ORF96 antibody
C1ORF96 antibody was raised using the N terminal Of C1Orf96 corresponding to a region with amino acids LGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPP
CTNNB1 antibody
CTNNB1 antibody was raised in Mouse using a purified recombinant fragment of human CTNNB1 expressed in E. coli as the immunogen.PDIA6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. Extensive studies have shown its high efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes several metabolic transformations, making it highly versatile in combating mycobacterium infections. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains, this drug effectively inhibits cell growth in culture.ST5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ST5 antibody, catalog no. 70R-10055Degré de pureté :Min. 95%ATP6AP1 antibody
ATP6AP1 antibody was raised using the middle region of ATP6AP1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGSCSHL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CSHL1 antibody, catalog no. 70R-6216
Degré de pureté :Min. 95%RGS20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS20 antibody, catalog no. 70R-1143Degré de pureté :Min. 95%CD3e antibody (Azide Free)
CD3e antibody (Azide free) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
ERBB3 antibody
ERBB3 antibody was raised in Mouse using a purified recombinant fragment of ERBB3(aa1175-1275) expressed in E. coli as the immunogen.
ENSA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENSA antibody, catalog no. 70R-4510Degré de pureté :Min. 95%NT5M Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NT5M antibody, catalog no. 70R-2441Degré de pureté :Min. 95%CHK2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and hinders cell growth in culture.SRF antibody
The SRF antibody is a powerful tool in biomedical research and diagnostics. It is an antibody that specifically targets the growth factor known as SRF (Serum Response Factor). This growth factor plays a crucial role in cell proliferation, differentiation, and survival. The SRF antibody can be used to study the function of SRF in various biological processes, including development, tissue repair, and disease progression.PTK2B antibody
PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPREEF1B2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EEF1B2 antibody, catalog no. 70R-2143Degré de pureté :Min. 95%CACHD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACHD1 antibody, catalog no. 70R-6902
Degré de pureté :Min. 95%Goat anti Human IgG (Fab'2) (FITC)
Goat anti-human IgG (Fab'2) (FITC) was raised in goat using human IgG F(ab')2 fragment as the immunogen.Degré de pureté :Min. 95%Osteocalcin antibody
The Osteocalcin antibody is a highly specialized antibody that targets osteopontin, a basic protein involved in bone formation and remodeling. This monoclonal antibody can be used in various research applications within the Life Sciences field. It specifically binds to osteopontin and can be utilized for experiments such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The Osteocalcin antibody has also been shown to exhibit cross-reactivity with other proteins such as serum albumin, E-cadherin, β-catenin, taxol, oncostatin, and angptl3. Its high specificity and sensitivity make it an invaluable tool for studying bone biology and related diseases.PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high activity has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
PTPMT1 antibody
The PTPMT1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, making it an essential tool for research and diagnostic purposes. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs.GLUT2 antibody
The GLUT2 antibody is a growth factor that has been activated and neutralized to provide effective results. It has been tested in human serum and has shown promising results in inhibiting the activity of alpha-fetoprotein, a protein associated with certain cancers. Additionally, this antibody has demonstrated the ability to block chemokine activity, which plays a role in inflammation and immune response.
SNRPA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPA1 antibody, catalog no. 70R-4716
Degré de pureté :Min. 95%KCTD18 antibody
KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNNC4ORF23 antibody
C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKKLHL20 antibody
KLHL20 antibody was raised in rabbit using the C terminal of KLHL20 as the immunogenDegré de pureté :Min. 95%Thiabendazole antibody
Thiabendazole antibody is a versatile product used in the field of Life Sciences. It is an antibody that specifically targets and binds to thiabendazole, a compound commonly found in collagen and β-catenin. This antibody has been extensively studied for its anti-mesothelin properties, making it an important tool in cancer research. Additionally, it has cytotoxic effects on target molecules and has shown promising results in inhibiting urokinase plasminogen activator activity. Thiabendazole antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs.Degré de pureté :Min. 95%IFRD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFRD1 antibody, catalog no. 70R-3682Degré de pureté :Min. 95%PLCG2 antibody
The PLCG2 antibody is a highly specialized antibody that targets the PLCG2 protein. This protein plays a crucial role in various cellular processes, including signal transduction and immune response. The antibody specifically recognizes and binds to the activated form of PLCG2, inhibiting its activity and preventing further downstream signaling.Degré de pureté :Min. 95%Fibroblast antibody
Fibroblast antibody was raised in mouse using whole human thymic stoma cells as the immunogen.
HER2 antibody
The HER2 antibody is a protein that belongs to the family of collagen antibodies. It is an anti-HER2 antibody that acts as a kinase inhibitor, targeting the epidermal growth factor receptor. This antibody is widely used in the field of Life Sciences for research purposes. It has been shown to inhibit the signaling pathways of HER2, which is involved in cell proliferation and survival. Additionally, the HER2 antibody has been found to have therapeutic potential in the treatment of various diseases, including breast cancer. It can be used in combination with other treatments, such as trastuzumab, a monoclonal antibody, to enhance their efficacy. The HER2 antibody can also be utilized in immunoassays and diagnostic tests due to its high specificity and sensitivity. Its diverse applications make it an essential tool for researchers and clinicians alike.Human Growth Hormone antibody
Human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.Degré de pureté :Min. 95%
