Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.568 produits)
- Par Biological Target(100.776 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(490 produits)
- Biologie végétale(6.904 produits)
- Métabolites secondaires(14.368 produits)
130538 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SLC25A25 antibody
SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRDegré de pureté :Min. 95%AF594 Donkey anti Rat IgG (H + L)
Donkey anti-rat IgG (H + L) (AF594) was raised in donkey using Rat IgG (H&L) as the immunogen.Degré de pureté :Min. 95%CCR7 antibody
The CCR7 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the CCR7 protein, which plays a crucial role in immune cell trafficking and migration. By binding to CCR7, this antibody inhibits the interaction between CCR7 and its ligands, such as TNF-α and leukemia inhibitory factor. This inhibition can have various effects on immune responses, including the modulation of autoantibodies production and the regulation of inflammatory processes.Akt antibody
Protein kinase B, also known as Akt or RAC-alpha serine/threonine-protein kinase, is a serum- and glucocorticoid-regulated kinase with three closely related isoforms: Akt1, Akt2, and Akt3. While Akt1 and Akt3 are primarily expressed in the brain, Akt2 is most abundant in skeletal muscle and embryonic brown fat. These isoforms are key regulators in various physiological functions, including cell growth, proliferation, survival, angiogenesis, and metabolism, and Akt is also recognized as a proto-oncogene due to its role in cancer-related processes.ALG1 antibody
ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVGDegré de pureté :Min. 95%RAP1A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively tested using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.VASH2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its effectiveness in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its efficacy has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The compound undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.
SLC25A31 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A31 antibody, catalog no. 70R-6470Degré de pureté :Min. 95%SNAP23 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNAP23 antibody, catalog no. 70R-2566Degré de pureté :Min. 95%XRCC4 antibody
The XRCC4 antibody is a polyclonal antibody that targets the XRCC4 protein, which plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is commonly used in chromatin immunoprecipitation assays to study the binding of XRCC4 to DNA and its interaction with other proteins. In the field of life sciences, this antibody is an essential tool for researchers studying DNA repair mechanisms and investigating potential inhibitors or modulators of XRCC4 activity. Additionally, studies have shown that XRCC4 may have neuroprotective effects and be involved in growth factor signaling pathways. The XRCC4 antibody can be used as a gene expression inhibitor to investigate the impact of XRCC4 on various cellular processes. Its use in research has led to significant advancements in our understanding of DNA repair mechanisms and their implications in disease development and treatment strategies.CASD1 antibody
CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEDegré de pureté :Min. 95%Rat IgG2b Isotype Control
The Rat IgG2b Isotype Control is a mouse monoclonal antibody that serves as a control for experiments involving rat IgG2b antibodies. It has the same amino acid sequence as the rat IgG2b antibody but lacks specificity for any particular antigen. This control antibody is commonly used in cytometry analysis to determine non-specific binding and background noise levels. It does not interfere with the antigen-antibody reaction and can be used to assess the specificity of other antibodies in various research applications, particularly in the field of Life Sciences. The Rat IgG2b Isotype Control contains 450 amino acid residues and has been validated for use in experiments involving mitogen-activated protein (MAP) kinase signaling pathways, cell surface markers, and potential biomarkers. It is an essential tool for researchers working with rat IgG2b antibodies and ensures accurate interpretation of experimental results.Degré de pureté :Min. 95%PRELID2 antibody
PRELID2 antibody was raised using the C terminal of PRELID2 corresponding to a region with amino acids GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAECRMP2 antibody
The CRMP2 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is designed to target and bind to CRMP2, a protein that plays a crucial role in the development and function of cardiomyocytes. By neutralizing CRMP2, this antibody can potentially inhibit certain cellular processes and provide therapeutic benefits.Histone H3.1 antibody
The Histone H3.1 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically targets histone H3.1, a protein involved in DNA packaging and gene regulation.Degré de pureté :Min. 95%CIRBP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CIRBP antibody, catalog no. 70R-4931Degré de pureté :Min. 95%Trichomonas vaginalis antibody
Trichomonas vaginalis antibody was raised in mouse using Trichomonas Vaginalis as the immunogen.RRP1 antibody
The RRP1 antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets the 6-phosphogluconate dehydrogenase (PGD) protein and has been shown to be an effective HDAC inhibitor. The antibody recognizes a phosphorylation site on the PGD protein, making it a valuable tool for studying post-translational modifications. Additionally, the RRP1 antibody can be used to detect and quantify the levels of PGD in various biological samples. Its high specificity and sensitivity make it an ideal choice for researchers working with retinoid signaling pathways, sirtuins, antinociceptive mechanisms, methyl transferases, and collagen activation. With its wide range of applications, the RRP1 antibody is an essential tool for any researcher in need of reliable and accurate detection of PGD protein expression.PDHA1 antibody
PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPEPD antibody
The PEPD antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and detects PEPD, which is an enzyme involved in adipose tissue metabolism. This antibody is widely used in research studies related to adipose tissue, autoantibodies, amyloid plaque formation, and lipase activity.ZFP57 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP57 antibody, catalog no. 70R-7892Degré de pureté :Min. 95%GATA4 antibody
The GATA4 antibody is a highly specific monoclonal antibody that has been widely used in life sciences research. It targets the GATA4 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. This antibody has been extensively validated for its specificity and sensitivity in various applications including Western blotting, immunohistochemistry, and immunofluorescence.HDAC5 antibody
The HDAC5 antibody is a polyclonal antibody that targets histidine deacetylase 5 (HDAC5). HDAC5 is a member of the histone deacetylase family and plays a crucial role in gene expression regulation. It is involved in various cellular processes, including β-catenin signaling, glutamate-induced cell death, and growth factor signaling pathways. The HDAC5 antibody specifically recognizes and binds to HDAC5, allowing for the detection and analysis of its expression levels in different biological samples.Neu antibody
Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.RAD54L antibody
RAD54L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
Degré de pureté :Min. 95%RUNX3 antibody
The RUNX3 antibody is a compound that acts as a biomarker and inhibits the activity of certain proteins. It is an antibody that can be used as a detection reagent in various applications. The RUNX3 antibody has anti-proliferative properties and can inhibit the growth of cells. It is commonly used in research and medical settings as a tool to study protein function and as a potential target for therapeutic interventions. This polyclonal antibody is highly specific and reliable, making it an ideal choice for those seeking a high-quality detection reagent or research tool.VNN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed for the treatment of tuberculosis infection and contains active compounds with bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. With its high frequency of human activity, it has been proven to be highly effective using a patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.SLC9A7 antibody
SLC9A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFIDegré de pureté :Min. 95%Goat anti Rat IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.Degré de pureté :Min. 95%
