Produits biochimiques et réactifs

<p>SRFBP1 antibody was raised in rabbit using the middle region of SRFBP1 as the immunogen</p>

<p>Purified lactoferrin from human milk.</p>

<p>The IL9 antibody is a polyclonal antibody used in Life Sciences research. It specifically binds to IL9, a cytokine that plays a crucial role in immune response and allergic reactions. The IL9 antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. It has been shown to neutralize the activity of IL9 by blocking its binding to its receptor. This antibody can be used to study the function of IL9 in different biological processes and may have potential therapeutic applications in diseases involving abnormal IL9 signaling.</p>

<p>Rabbit polyclonal CD3 zeta antibody (Tyr142)</p>

<p>Mouse monoclonal RALBP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPB1 antibody, catalog no. 70R-5447</p>

<p>Rabbit polyclonal TIN2 antibody</p>

<p>The SHC1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the SHC1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used to study the function of SHC1 and its involvement in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC10A1 antibody, catalog no. 70R-7046</p>

<p>Leptin antibody was raised in rabbit using highly pure recombinant human leptin as the immunogen.</p>

<p>BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS</p>

<p>Rabbit polyclonal SYN1 antibody (Ser605)</p>

<p>The DHPS antibody is a highly specific monoclonal antibody that targets the epidermal growth factor receptor (EGFR) pathway. It plays a crucial role in regulating cell growth, proliferation, and survival. This antibody has been extensively studied in Life Sciences research and has proven to be an invaluable tool for studying various cellular processes.</p>

<p>Rabbit polyclonal LAMB2 antibody</p>

<p>The Raf1 antibody is a cytotoxic monoclonal antibody that targets the Raf1 protein, a key component of the MAPK signaling pathway. This antibody specifically binds to tyrosine-phosphorylated Raf1 and inhibits its activity, leading to the suppression of downstream signaling events. The Raf1 antibody has been extensively used in research studies to investigate the role of Raf1 in various cellular processes, such as cell proliferation, differentiation, and survival. It is commonly used in techniques like immunohistochemistry and Western blotting to detect the expression and activation status of Raf1 in different tissues and cell types. Additionally, this antibody has been employed in drug development efforts to test the efficacy of Raf1 inhibitors as potential cancer therapeutics. Its high specificity and sensitivity make it an invaluable tool for scientists working in the field of Life Sciences who aim to understand the complex mechanisms underlying cellular function and disease progression.</p>

<p>1-221 amino acids: MGSSHHHHHH SSGLVPRGSH MSDGDYDYLI KFLALGDSGV GKTSVLYQYT DGKFNSKFIT TVGIDFREKR VVYRASGPDG ATGRGQRIHL QLWDTAGQER FRSLTTAFFR DAMGFLLLFD LTNEQSFLNV RNWISQLQMH AYCENPDIVL CGNKSDLEDQ RVVKEEEAIA LAEKYGIPYF ETSAANGTNI SQAIEMLLDL IMKRMERCVD KSWIPEGVVR SNGHASTDQL SEEKEKGACG C</p>

<p>The Nod2 antibody is a highly specialized monoclonal antibody that binds to the Nod2 receptor. This receptor is involved in various cellular processes and plays a crucial role in immune responses. The Nod2 antibody has been extensively studied and proven to have high affinity and specificity for its target.</p>

<p>Purified Polyclonal Beta arrestin 1 antibody</p>

<p>Rabbit polyclonal SNCA antibody (ser129)</p>

<p>NECAP2 antibody was raised in Rabbit using Human NECAP2 as the immunogen</p>

<p>Feline RBC antibody was raised in rabbit using feline erythrocytes as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RDH11 antibody, catalog no. 70R-5410</p>

<p>FAM120A antibody was raised using the middle region of FAM120A corresponding to a region with amino acids SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAE</p>

<p>Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG</p>

<p>GCH1 antibody was raised in rabbit using the C terminal of GCH1 as the immunogen</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>BTD antibody was raised in Rabbit using Human BTD as the immunogen</p>

<p>ATP5H antibody was raised in Rabbit using Human ATP5H as the immunogen</p>

<p>GOT1 protein is a monoclonal antibody that specifically targets and neutralizes TNF-α, an acidic protein involved in inflammatory responses. This recombinant virus-derived protein has been extensively tested and shown to effectively bind to TNF-α in human blood serum samples. By inhibiting the activity of TNF-α, GOT1 protein helps reduce inflammation and provides therapeutic benefits for various conditions. In addition, this conjugated protein has low viscosity, making it suitable for use in assays and other research applications. With its high specificity and inhibitory factor against TNF-α, GOT1 protein offers a valuable tool for studying immune responses and developing targeted therapies.</p>

<p>ALG6 antibody was raised in Rabbit using Human ALG6 as the immunogen</p>

<p>The GPRC5A antibody is a monoclonal antibody widely used in Life Sciences research. It is specifically designed to target GPRC5A, a protein that plays a crucial role in various cellular processes. This antibody has been shown to have neutralizing effects on GPRC5A, making it an excellent tool for studying the function and regulation of this protein.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTH antibody, catalog no. 70R-1982</p>

<p>The SIGLEC9 antibody is a highly specialized monoclonal antibody that targets and inhibits the growth factor protein known as VEGF (vascular endothelial growth factor). This antibody has antiangiogenic properties, meaning it prevents the formation of new blood vessels. By blocking VEGF, the SIGLEC9 antibody hinders the growth and spread of tumors.</p>

<p>ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen</p>

<p>Rabbit polyclonal DFF45 antibody</p>

<p>Mouse anti Human IgG (Fc Specific) antibody was raised in Mouse using purified fusion protein with human IgG(Fc Specific) tag as the immunogen.</p>

<p>Rabbit polyclonal EpoR antibody (Tyr368)</p>

<p>HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV</p>

<p>Purified recombinant Human CLEC2D protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Anxa6 antibody, catalog no. 20R-1257</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF19 antibody, catalog no. 70R-1049</p>

<p>Interdigitating cell antibody was raised in mouse using rat peritoneal macrophages as the immunogen.</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>CYP3A4 antibody was raised using the middle region of CYP3A4 corresponding to a region with amino acids MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1A1 antibody, catalog no. 70R-4584</p>

<p>CAPG antibody was raised in Rabbit using Human CAPG as the immunogen</p>

<p>The CD15 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor CD15. It has been extensively studied for its potential therapeutic applications in various fields, including autoantibodies, interferon, and growth factor research. This antibody has shown great promise in neutralizing the effects of CD15, thereby inhibiting the activity of this chemokine receptor.</p>

<p>BCAT1 antibody was raised in Rabbit using Human BCAT1 as the immunogen</p>

<p>Shc1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets Shc1, a protein involved in various cellular processes, including signal transduction and cell proliferation. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting Shc1 in human serum samples. It can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.</p>