Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
SUCLG2 antibody
The SUCLG2 antibody is a highly effective medicament that is used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the amino-terminal region of SUCLG2, an enzyme involved in the production of creatine kinase. This antibody has been extensively studied and has shown great potential in various applications.HNRPA1 antibody
HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGESX1 antibody
ESX1 antibody was raised in rabbit using the N terminal of ESX1 as the immunogen
Degré de pureté :Min. 95%GMP synthase protein (His tag)
Purified recombinant Human GMP synthase protein (His tag)Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Degré de pureté :Min. 95%LTA4H antibody
LTA4H antibody was raised using the middle region of LTA4H corresponding to a region with amino acids NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGDegré de pureté :Min. 95%CEACAM19 antibody
CEACAM19 antibody was raised using the middle region of CEACAM19 corresponding to a region with amino acids MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNADegré de pureté :Min. 95%CDC27 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC27 antibody, catalog no. 70R-4087Degré de pureté :Min. 95%WNT3A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WNT3A antibody, catalog no. 70R-5284Degré de pureté :Min. 95%GAS7 antibody
GAS7 antibody was raised in mouse using recombinant human GAS7 (1-416aa) purified from E. coli as the immunogen.
Dopamine D3 Receptor antibody
Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.Degré de pureté :Min. 95%FLJ35767 antibody
FLJ35767 antibody was raised using the middle region of FLJ35767 corresponding to a region with amino acids PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSMETTL7A antibody
METTL7A antibody was raised using the N terminal of METTL7A corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNSTK39 antibody
STK39 antibody was raised using a synthetic peptide corresponding to a region with amino acids CAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIPARP16 antibody
PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLLDegré de pureté :Min. 95%LTA4H antibody
The LTA4H antibody is a monoclonal antibody that specifically targets the antigen LTA4H. It is colloidal in nature and belongs to the class of monoclonal antibodies. This antibody has been widely used in various applications in the field of Life Sciences, including immunoassays and research studies. The LTA4H antibody has shown high specificity and sensitivity in detecting LTA4H, making it a valuable tool for researchers studying this antigen. It can be used in experiments involving carbon quantum dots, steroids, collagen, ketamine, and other related compounds. Additionally, this antibody can also be utilized for the detection of autoantibodies or as a therapeutic agent targeting specific diseases. The LTA4H antibody is supplied in a buffered solution to ensure stability and optimal performance.
Akt antibody (Thr308)
Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.Itga7 antibody
Itga7 antibody was raised in rabbit using the N terminal of Itga7 as the immunogenDegré de pureté :Min. 95%SPATA6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA6 antibody, catalog no. 70R-3951
Degré de pureté :Min. 95%B4galt6 antibody
B4galt6 antibody was raised in rabbit using the C terminal of B4galt6 as the immunogenDegré de pureté :Min. 95%Oncostatin M protein
Region of Oncostatin M protein corresponding to amino acids MAAIGSCSKE YRVLLGQLQK QTDLMQDTSR LLDPYIRIQG LDVPKLREHC RERPGAFPSE ETLRGLGRRG FLQTLNATLG CVLHRLADLE QRLPKAQDLE RSGLNIEDLE KLQMARPNIL GLRNNIYCMA QLLDNSDTAE PTKAGRGASQ PPTPTPASDA FQRKLEGCRF LHGYHRFMHS VGRVFSKWGE SPNRSRRHSP HQALRKGVRR.
Degré de pureté :Min. 95%SLC27A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC27A5 antibody, catalog no. 70R-7500Degré de pureté :Min. 95%SLC30A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC30A1 antibody, catalog no. 70R-7370Degré de pureté :Min. 95%CYP21A2 antibody
CYP21A2 antibody was raised in rabbit using the C terminal of CYP21A2 as the immunogen
Degré de pureté :Min. 95%ARPC3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARPC3 antibody, catalog no. 70R-3073Degré de pureté :Min. 95%STATH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STATH antibody, catalog no. 70R-5453Degré de pureté :Min. 95%DAZAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DAZAP1 antibody, catalog no. 70R-1355Degré de pureté :Min. 95%DHFR antibody
The DHFR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various proteolytic processes and is commonly used in immunoassays to detect and quantify the presence of DHFR protein. This antibody specifically targets and binds to the DHFR enzyme, inhibiting its activity and preventing the conversion of dihydrofolate to tetrahydrofolate. By doing so, it disrupts essential cellular processes such as DNA synthesis, repair, and methylation. The DHFR antibody has also been shown to activate the p38 mitogen-activated protein kinase pathway and induce endonuclease activity in certain cell types. Its acidic nature allows for efficient penetration into cells and binding to nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) transcription factors, influencing gene expression patterns. Researchers rely on the high specificity and sensitivity of this monoclonal antibody for accurate analysis of DHFR-related pathways and understanding its role in growth regulationGoat anti Mouse IgG (Fab'2) (PE)
Goat anti-mouse IgG (Fab'2) (PE) was raised in goat using murine IgG F(ab’)2 fragment as the immunogen.Degré de pureté :Min. 95%MAPK13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK13 antibody, catalog no. 70R-5668
Degré de pureté :Min. 95%GAPDH Blocking Peptide
The GAPDH Blocking Peptide is a powerful tool used in Life Sciences research. It is a ligase that acts as a blocking peptide for glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This peptide specifically inhibits the activity of GAPDH, an essential enzyme involved in glycolysis and other cellular processes. By blocking the function of GAPDH, researchers can study the impact of its inhibition on various cellular pathways and processes. The GAPDH Blocking Peptide is widely used in biochemical and molecular biology studies, providing valuable insights into the role of this enzyme in cellular functions. With its high quality and effectiveness, this peptide is a valuable addition to any research project in the field of Life Sciences.
Degré de pureté :Min. 95%RLBP1 antibody
The RLBP1 antibody is a monoclonal antibody that targets RLBP1, a protein involved in the regulation of microvessel density. This antibody acts as an anticoagulant by binding to RLBP1 and inhibiting its function. It has been shown to reduce fibrinogen levels and inhibit the production of acidic TNF-α, a growth factor involved in inflammation. Additionally, the RLBP1 antibody has been found to have multidrug properties, as it can bind to and neutralize the effects of various antibodies such as adalimumab. Its mechanism of action involves targeting activated nuclear receptors and modulating their activity. With its unique characteristics, the RLBP1 antibody offers potential therapeutic applications in the field of vascular biology and inflammation research.LRRC66 antibody
LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW
Degré de pureté :Min. 95%
