Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.116 produits)
- Par Biological Target(99.075 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.700 produits)
- Métabolites secondaires(14.220 produits)
130578 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
RFT1 antibody
<p>RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV</p>Degré de pureté :Min. 95%PDZRN4 antibody
<p>PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL</p>ZNF567 antibody
<p>ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogen</p>Degré de pureté :Min. 95%KCNH2 antibody
<p>KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG</p>Degré de pureté :Min. 95%CD90 antibody
<p>The CD90 antibody is a monoclonal antibody that targets the sclerostin protein. It is used to neutralize the activity of sclerostin, which is a negative regulator of bone growth. By blocking sclerostin, the CD90 antibody promotes bone formation and can potentially be used in the treatment of conditions such as osteoporosis.</p>PPP2R1B antibody
<p>PPP2R1B antibody was raised using a synthetic peptide corresponding to a region with amino acids EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ</p>Degré de pureté :Min. 95%4EBP1 antibody
<p>The 4EBP1 antibody is a polyclonal antibody that belongs to the class of drug antibodies. It is widely used in life sciences research as an inhibitor and neutralizing agent. This antibody specifically targets and binds to 4EBP1, a family of binding proteins involved in regulating protein synthesis. The 4EBP1 antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It is buffered and optimized for use in different experimental conditions. Whether you are studying interleukins, ranolazine, or other chimeric proteins, the 4EBP1 antibody is a valuable tool for detecting and analyzing activated proteins. With its high specificity and sensitivity, this monoclonal antibody ensures accurate and reliable results in your research experiments.</p>ZNF365 antibody
<p>ZNF365 antibody was raised in rabbit using the N terminal of ZNF365 as the immunogen</p>Degré de pureté :Min. 95%RHPN1 antibody
<p>RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP</p>LONRF2 antibody
<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR</p>Degré de pureté :Min. 95%SNAPC4 antibody
<p>SNAPC4 antibody was raised in mouse using recombinant Small Nuclear Rna Activating Complex, Polypeptide 4,190Kda (Snapc4)</p>C9ORF127 antibody
<p>C9ORF127 antibody was raised using the C terminal Of C9Orf127 corresponding to a region with amino acids CYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS</p>Degré de pureté :Min. 95%ALK1 protein
<p>ALK1 protein is a biomolecule that plays a crucial role in various biological processes. It is a growth factor receptor that belongs to the transforming growth factor-beta (TGF-β) receptor family. ALK1 protein is activated by binding to ligands such as adalimumab and dopamine, which triggers intracellular signaling pathways involved in cell proliferation, differentiation, and migration.</p>Degré de pureté :Min. 95%Troponin T antibody (Cardiac)
<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>ZNF237 antibody
<p>ZNF237 antibody was raised in rabbit using the N terminal of ZNF237 as the immunogen</p>Degré de pureté :Min. 95%Karyopherin α 1 antibody
<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>2002-G12
CAS :<p>2002-G12 is a peptide that can be used as a research tool to study protein interactions and receptor ligand pharmacology. It has been shown to inhibit the activity of ion channels, such as potassium channels. 2002-G12 is an activator of antibody production. It may also be used to study cell biology, including the interactions between proteins in cells and their receptors, which are targets for drug development. This peptide has high purity and can be obtained with CAS No. 313666-93-2.</p>Formule :C20H16N6Degré de pureté :Min. 95%Masse moléculaire :340.4 g/molNORE1 antibody
<p>NORE1 antibody was raised in rabbit using residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein as the immunogen.</p>Degré de pureté :Min. 95%PPP1R13B antibody
<p>PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA</p>Degré de pureté :Min. 95%Chicken anti Rabbit IgG (H + L) (HRP)
<p>Chicken anti Rabbit IgG secondary antibody (FITC)</p>Degré de pureté :Min. 95%DOR1 antibody
<p>DOR1 antibody was raised in rabbit using a synthetic peptide comprising residues 361-372 TPSDGPGGGAAA of the human DOR-1 protein as the immunogen.</p>Degré de pureté :Min. 95%TIMP1 protein
<p>The TIMP1 protein is a versatile molecule with various characteristics and functions. It has been found to have interactions with interleukin-6, a basic protein that plays a crucial role in immune responses. Additionally, it has been shown to be involved in the formation of autoantibodies and possesses acetyltransferase activity.</p>Degré de pureté :Min. 95%Ubiquitin antibody
<p>The Ubiquitin antibody is a cytotoxic monoclonal antibody that has neutralizing properties against ferritin, chemokines, and interferons. It is a glycoprotein that specifically targets ubiquitin, a protein involved in various cellular processes such as protein degradation and DNA repair. This antibody can be used in Life Sciences research to study the role of ubiquitin in different biological pathways. The Ubiquitin antibody has been tested for its efficacy in inhibiting hemolysis and has shown promising results. It does not contain any excipients or liver microsomes, making it safe for use in laboratory experiments.</p>Degré de pureté :Min. 95%HIST1H1T antibody
<p>HIST1H1T antibody was raised using the middle region of HIST1H1T corresponding to a region with amino acids KLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRAT</p>
