Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.555 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130582 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Parainfluenza type 2 antibody (FITC)
Parainfluenza type 2 antibody (FITC) was raised in mouse using parainfluenza virus, type 2 as the immunogen.CD19 antibody (CY5)
CD19 antibody (CY5) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD19 antibody (PE)
CD19 antibody (PE) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD3e antibody (Allophycocyanin)
CD3e antibody (Allophycocyanin) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD18 antibody (PE)
CD18 antibody (PE) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.Degré de pureté :Min. 95%CD45R antibody (Spectral Red)
CD45R antibody (PE-CY5.5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molN-(2-Methoxyethyl)-3-[[4-(1-methyl-1H-pyrazol-4-yl)phenyl]methyl]-1H-indazole-5-carboxamide
CAS :N-(2-Methoxyethyl)-3-[[4-(1-methyl-1H-pyrazol-4-yl)phenyl]methyl]-1H-indazole-5-carboxamide (MTPC) is a peptide that binds to the receptor site of the human G protein coupled receptor, which is important in signal transduction. MTPC has been shown to inhibit ion channels and reduce neuronal excitability. This compound is a high purity reagent for research purposes. It is used as an inhibitor of ligands binding to receptors or ion channels, or as a pharmacological tool for studying the function of these proteins.Formule :C22H23N5O2Degré de pureté :Min. 95%Masse moléculaire :389.4 g/molAnti NPY (Human, Rat, Mouse) Serum
This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.Degré de pureté :Min. 95%CD3e antibody (PE)
CD3e antibody (PE) was raised in mouse using porcine CD3e as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD44 antibody (Allophycocyanin)
CD44 antibody (Allophycocyanin) was raised in mouse using chicken CD44 as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD16 antibody (PE-CY7)
CD16 antibody (PE) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD40 antibody (Spectral Red)
CD40 antibody (Spectral Red) was raised in rat using CD40 as the immunogen
Degré de pureté :Min. 95%Masse moléculaire :0 g/molC2orf25 antibody
C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHLCD25 antibody (FITC)
CD25 antibody (FITC) was raised in rat using IL-2-dependent BALB/c murine helper T-cell clone HT-2 as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD45RB antibody
CD45RB antibody was raised in rat using cloned mouse Th2 cell lines as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD28 antibody (Spectral Red)
CD28 antibody (Spectral Red) was raised in hamster using CD28 costimulatory receptor as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD45.1 antibody (PE)
CD45 antibody (PE) was raised in Rat using CD45/LCA as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD31 antibody (PE-CY7)
CD31 antibody (PE-CY7) was raised in Rat using mouse leukocyte cell line 32D as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molAnti Acidic-FGF (1-15) (Bovine) Serum
Anti Acidic-FGF (1-15) (Bovine) Serum is a research tool used to study the activation of FGF receptors and their ligands. It contains peptides that are derived from the extracellular domain of human acidic FGF (1-15). This serum stimulates the activation of FGF receptors, which are important in cell growth, proliferation, and survival. Anti Acidic-FGF (1-15) Serum is purified by ion exchange chromatography and contains no detectable amounts of other proteins. It is supplied as a lyophilized powder at a concentration of 10 mg/mL.Degré de pureté :Min. 95%Insulin II (Rat, Mouse)
CAS :Insulin II is a peptide hormone that is secreted by the beta cells of the pancreas. Insulin II regulates glucose metabolism, promotes protein synthesis and inhibits lipolysis. It can be used as a research tool to study protein interactions, activators and ligands, receptor binding and ion channel activity. Insulin II can also be used to generate monoclonal antibodies against insulin II. This product has the three code sequence: A-chain: Gly-Ile-Val-Asp-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn ; B-chain:Phe-Val-Lys-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Met-Ser, has the disulfide bonds: CysA6-CysA11, CysA7-CysB7, and CysA20-CysB19 and is available as a 50 µg vial.Formule :C256H382N64O76S7Degré de pureté :Min. 95%Masse moléculaire :5,796.6 g/molMaleimide activated-KLH
This product is produced via the activation of mariculture Keyhole Limpet (Megathura crenulata) Hemocyanin with a maleimide group. The activated material will readily bind free sulfhydryl groups present in solution.KLH is a highly antigenic protein with a high molecular mass (4.5 x 105 - 1.3 x 107 Daltons, in aggregates of 350 and 390 kDa subunits) that elicits a strong immune response when used to immunize animals.As many as 400 moles of Cysteine-containing peptide can bind to one mole of maleimide-activated KLH.Degré de pureté :Min. 95%Enolase-1, human, recombinant
Enolase-1 is a glycolytic enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. It is a homotetrameric enzyme composed of two alpha and two beta subunits. Enolase-1 has been shown to be an ion channel in some cells, and has been implicated in the regulation of cellular processes such as cell proliferation, migration, and apoptosis. The recombinant protein is produced by HEK293 cells and purified by proprietary chromatography techniques.Degré de pureté :Min. 95%CD23 antibody (biotin)
CD23 antibody (biotin) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD21 antibody (FITC)
CD21 antibody (FITC) was raised in mouse using porcine CD21 as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD28 antibody (biotin)
CD28 antibody (biotin) was raised in hamster using CD28 costimulatory receptor as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD49b antibody (Allophycocyanin-CY7)
CD49b antibody (Allophycocyanin) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD3e antibody (CY5)
CD3e antibody (CY5) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD16 antibody (biotin)
CD16 antibody (biotin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD154/CD40L muCD8 Fusion protein (biotin)
Purified recombinant Human CD154/CD40L muCD8 Fusion protein (biotin)Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD44 antibody (PE-CY7)
CD44 antibody (PE) was raised in mouse using human CD44 as the immunogenDegré de pureté :Min. 95%Masse moléculaire :0 g/molCD106 antibody (Azide Free)
CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.CD25 antibody (biotin)
CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD30 antibody (PE)
CD30 antibody (PE) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD3e antibody (PE)
CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD45RC antibody (FITC)
CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD49d antibody (PE)
CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molBoc-Arg(Boc)2-OH
CAS :Boc-Arg(Boc)2-OH is a protected derivative of the amino acid arginine. The Boc (tert-butyloxycarbonyl) groups shield both the amino group and the side chain's guanidine functionality. This protection scheme allows for its selective incorporation during peptide synthesis while offering stability under various reaction conditions. Boc-Arg(Boc)2-OH has been also used in the synthesis of amino acid prodrugs of cytotoxic anthraquinones, demonstrating its potential utility in developing targeted cancer therapies.Formule :C21H38N4O8Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :474.55 g/molPTTG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PTTG2 antibody, catalog no. 70R-8929Degré de pureté :Min. 95%Carcinoembryonic Cancer Antigen (CEA)
Please enquire for more information about Carcinoembryonic Cancer Antigen (CEA) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFgf3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Fgf3 antibody, catalog no. 70R-8531Degré de pureté :Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (FITC) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD19 antibody (biotin)
CD19 antibody (biotin) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molCD25 antibody (biotin)
CD25 antibody (biotin) was raised in rat using alpha chain IL-2 receptor as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/mol
![N-(2-Methoxyethyl)-3-[[4-(1-methyl-1H-pyrazol-4-yl)phenyl]methyl]-1H-indazole-5-carboxamide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FJAD50015.webp&w=3840&q=75)
