Produits biochimiques et réactifs

<p>Purified recombinant EIF2S1 protein (His tag)</p>

<p>The HLAG antibody is a neuroprotective monoclonal antibody that targets the activated form of epidermal growth factor binding proteins. It is commonly used in Life Sciences research as an inhibitor of growth factors. The HLAG antibody has shown promising results in various studies and is often used in combination with other monoclonal antibodies, such as trastuzumab, to enhance its therapeutic effects. This antibody has also been tested on electrodes and liver microsomes, demonstrating its potential applications beyond neuroprotection. Additionally, the HLAG antibody has been found to have antagonist binding properties, specifically targeting glycine receptors. Its versatility and effectiveness make it a valuable tool for researchers in the field of Life Sciences.</p>

<p>Mouse monoclonal Dynactin 1 antibody (N-terminus)</p>

<p>Rabbit polyclonal TGF alpha antibody (FITC)</p>

<p>PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG</p>

<p>Rat monoclonal CD38 antibody (PE)</p>

<p>Purified Rabbit polyclonal DRP2 antibody (Thr514)</p>

<p>ADRA1D antibody was raised in rabbit using the C terminal of ADRA1D as the immunogen</p>

<p>The CD154 antibody is a monoclonal antibody that has various biological effects on the immune system. It interacts with CD40, a cell surface receptor, and plays a crucial role in immune responses. The CD154 antibody can stimulate the production of colony-stimulating factors and growth factors, which promote the growth and differentiation of leukocytes. It also enhances the expression of major histocompatibility complex class II molecules, facilitating antigen presentation to T cells. In addition, the CD154 antibody has been shown to inhibit low-density lipoprotein uptake by human serum macrophages. This antibody is widely used in life sciences research, including immunoassays and studies on thrombotic microangiopathy. Its binding to CD40 on human endothelial cells can trigger cellular activation and influence glycoprotein expression. With its diverse functions and applications, the CD154 antibody is an essential tool for understanding immune responses and developing therapeutic strategies in various fields of research.</p>

<p>The HSC70 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets HSC70, a member of the heat shock protein family that plays a crucial role in cellular processes such as protein folding and transport. This antibody has been extensively studied and validated for its ability to detect HSC70 in various applications.</p>

<p>KLHL21 antibody was raised in Mouse using a purified recombinant fragment of human KLHL21 expressed in E. coli as the immunogen.</p>

<p>Full length Hepatitis B core antigen protein (183 amino acids).</p>

<p>SLC30A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY</p>

<p>DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE</p>

<p>The LSP1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the collagen-activated isoenzyme of glucose-6-phosphate creatine kinase (G6PC). This antibody has been extensively studied and validated for its effectiveness in various applications, including the detection and quantification of G6PC in mesenchymal stem cells.</p>

<p>The SMP30 antibody is a polyclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been extensively studied and validated for its use in various applications, including transcription-polymerase chain reaction (PCR) analysis, immunohistochemistry staining, and Western blotting. It shows high specificity and sensitivity in detecting AFP in different samples, such as human serum and tissue sections.</p>

<p>Rabbit Polyclonal PIP5K antibody (Ser307)</p>

<p>Rabbit polyclonal SENP3 antibody</p>

<p>SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY</p>

<p>IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ</p>

<p>Mouse monoclonal Aprotinin antibody (Biotin)</p>

<p>The FR alpha antibody is a monoclonal antibody that specifically targets the FR alpha protein. This protein plays a crucial role in various biological processes, including fibrinogen binding, chemokine signaling, and E-cadherin-mediated cell adhesion. The FR alpha antibody is widely used in life sciences research to study the function and regulation of this protein.</p>

<p>Complement C9 antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>The GADD153 antibody is a glycoprotein that is widely used in the field of life sciences and medicine. It is an essential tool for researchers working with pluripotent stem cells, as it can be used to detect the activation of GADD153, a key regulator of cell differentiation and apoptosis. The GADD153 antibody is also commonly used as a serum marker to monitor the effectiveness of certain drugs or treatments.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using advanced techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>NOL5A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK</p>

<p>The NEUROG3 antibody is a highly specialized cytotoxic agent that targets dinitrophenyl (DNP) antigens. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown strong binding affinity to DNP antigens, leading to the lysis of cells expressing these antigens. The NEUROG3 antibody can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting. Its unique glycosylation pattern ensures optimal binding and specificity. Additionally, this antibody has been shown to inhibit endothelial growth and interfere with β-catenin signaling pathways. With its potent cytotoxic properties and broad range of applications, the NEUROG3 antibody is a valuable tool for researchers in the field of enteroendocrine biology and beyond.</p>

<p>10X concentrate ELISA wash buffer, ready to use</p>

<p>ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS</p>

<p>The TLR7 antibody is a powerful tool in the field of life sciences. This antibody specifically targets Toll-like receptor 7 (TLR7), which plays a crucial role in the immune response to viral infections. The TLR7 antibody is designed to bind to TLR7 and block its activity, preventing the activation of downstream signaling pathways.</p>

<p>Rabbit polyclonal ELOVL3 antibody</p>

<p>The CPA1 antibody is a monoclonal antibody that specifically targets the CPA1 enzyme. This antibody has been extensively studied for its protease activity and its potential applications in the field of life sciences. It has been shown to effectively inhibit the activity of CPA1, which plays a crucial role in various physiological processes.</p>

<p>Rabbit polyclonal PARP3 antibody</p>

<p>Mouse monoclonal OGFOD1 antibody</p>

<p>Purified Polyclonal CEBP delta/epsilon antibody</p>

<p>DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS</p>

<p>TTC6 antibody was raised using the C terminal of TTC6 corresponding to a region with amino acids MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY</p>

<p>C10 antibody was raised in rabbit using highly pure recombinant murine C10 as the immunogen.</p>

<p>11-Dodecenyl acetate is a pheromone that is used in insect behavioral responses. It is found to be more effective for host plant volatiles and has been shown to elicit a behavioral response in lepidoptera, such as the tobacco budworm moth. It is also used as a synthetic pheromone because of its high efficacy and low cost. 11-Dodecenyl acetate has been shown to have functional groups that are capable of eliciting an odorant response. It has been shown to be upwind and can act as a binary or ternary mixture with other chemicals, such as hexadecanoic acid.</p>

<p>Mouse monoclonal GLP1 antibody (Biotin)</p>

<p>The JAml antibody is a highly effective medicament that consists of monoclonal antibodies. These antibodies are specifically designed to target and bind to nuclear proteins, making them ideal for various biochemical applications. The JAml antibody has been extensively tested and proven to be highly specific and sensitive in detecting the presence of helicobacter in samples. It can also be used to study the activation of various cellular pathways, as it binds to an amide group found in activated proteins. Additionally, the JAml antibody has shown promising results in regulating e-cadherin expression, a glycoprotein involved in cell adhesion. With its colloidal microsphere formulation, this antibody is easy to use and delivers accurate results. Whether you're conducting research or working in the field of life sciences, the JAml antibody is an indispensable tool for your laboratory.</p>

<p>DDB2 antibody was raised in mouse using recombinant Human Damage-Specific Dna Binding Protein 2, 48Kda (Ddb2)</p>

<p>SLC10A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP</p>

<p>Mouse monoclonal PSMB7 antibody</p>

<p>BCL10 antibody was raised in rabbit using C terminal sequence [EMFLPLRSRTVSRQC] of Bcl10 as the immunogen.</p>

<p>Ceforanide (USP grade powder) chemical reference substance</p>

<p>FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>