Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.563 produits)
- Par Biological Target(101.024 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CCT6B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCT6B antibody, catalog no. 70R-4432
Degré de pureté :Min. 95%CLIC2 antibody
CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGBMX antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, ultimately inhibiting bacterial growth. The efficacy of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.ASPA antibody
ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSSR140 antibody
SR140 antibody was raised using the middle region of SR140 corresponding to a region with amino acids KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEEFBXO8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO8 antibody, catalog no. 70R-3127Degré de pureté :Min. 95%HMGCL antibody
HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKLDegré de pureté :Min. 95%CCDC28A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC28A antibody, catalog no. 70R-9315
Degré de pureté :Min. 95%Nucleolin antibody
Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED
DLX5 antibody
The DLX5 antibody is a highly specialized and potent tool in the field of life sciences. It is a polyclonal antibody that specifically targets DLX5, a transcription factor involved in various cellular processes. This antibody can be used for research purposes, such as studying the role of DLX5 in development and disease progression.Troponin I Type 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TNNI1 antibody, catalog no. 70R-3601Degré de pureté :Min. 95%C1S antibody
The C1S antibody is a monoclonal antibody that belongs to the field of Life Sciences. It specifically targets an insulin-like antigen and has been shown to play a role in sumoylation, which is the process of attaching Small Ubiquitin-like Modifier (SUMO) proteins to target proteins. This antibody can be used in various research applications, including the study of tyrosine signaling pathways and the detection of alpha-synuclein, a protein associated with neurodegenerative disorders.Armcx1 antibody
Armcx1 antibody was raised in rabbit using the C terminal of Armcx1 as the immunogenDegré de pureté :Min. 95%ANKRD5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD5 antibody, catalog no. 70R-3386Degré de pureté :Min. 95%Desmocollin 2 antibody
Desmocollin 2 antibody is a monoclonal antibody that has been specifically developed for use in Life Sciences research. It is produced by hybridoma cells and is activated to ensure optimal performance. This antibody targets desmocollin 2, which is an important protein involved in cell adhesion. By binding to desmocollin 2, this antibody can be used to study its function and role in various biological processes.CMTM2 antibody
CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLLDegré de pureté :Min. 95%MMP1 antibody
MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKAHemoglobin protein (Guinea Pig)
Purified native Hemoglobin protein (Guinea Pig)Degré de pureté :Min. 95%SMARCD3 antibody
The SMARCD3 antibody is a monoclonal antibody that targets the tyrosinase enzyme. It has been shown to inhibit the activity of tyrosinase, which plays a crucial role in melanogenesis. This antibody specifically binds to tyrosinase and forms an antigen-antibody complex, leading to the inhibition of its function.
