Produits biochimiques et réactifs

<p>Rabbit polyclonal MNK1 antibody</p>

<p>PF4 antibody was raised in rabbit using highly pure recombinant hPF-4 as the immunogen.</p>

<p>CHSY2 antibody was raised using the N terminal Of Chsy-2 corresponding to a region with amino acids PPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNG</p>

<p>Purified Polyclonal TNF beta antibody</p>

<p>Rabbit polyclonal IL8 antibody (biotin)</p>

<p>1-171 amino acids: MGSSHHHHHH SSGLVPRGSH MAKFVIRPAT AADCSDILRL IKELAKYEYM EEQVILTEKD LLEDGFGEHP FYHCLVAEVP KEHWTPEGHS IVGFAMYYFT YDPWIGKLLY LEDFFVMSDY RGFGIGSEIL KNLSQVAMRC RCSSMHFLVA EWNEPSINFY KRRGASDLSS EEGWRLFKID KEYLLKMATE E</p>

<p>Biotin conjugated Rabbit polyclonal Ovalbumin antibody</p>

<p>TrkC antibody was raised in goat using the entire extracellular domain of rat TrkC receptor as the immunogen.</p>

<p>The EGFL6 antibody is a highly specialized antibody that targets the steroid hormone β-catenin. It is available in both polyclonal and monoclonal forms, making it suitable for various research applications. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy.</p>

<p>BTN2A1 antibody was raised in Rabbit using Human BTN2A1 as the immunogen</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified Rabbit polyclonal ELSPBP1 antibody</p>

<p>WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV</p>

<p>The Phytase antibody is a Monoclonal Antibody that is used in various applications in the Life Sciences field. It is produced by hybridoma cells and has been extensively studied for its antigen-antibody reaction properties. This antibody can be used in assays to detect and quantify phytase, an enzyme that plays a crucial role in the breakdown of phytic acid, a compound found in plants.</p>

<p>The Nestin antibody is a monoclonal antibody used in Life Sciences research. It specifically targets Nestin, a protein that is highly expressed in cells of the central nervous system during development and in certain types of tumors. This antibody has been shown to have a high affinity for Nestin and can be used for various applications, including immunohistochemistry and Western blotting. Additionally, studies have indicated that the Nestin antibody may have therapeutic potential in the treatment of certain diseases, such as cancer and neurodegenerative disorders. Its ability to inhibit tumor growth and induce apoptosis makes it a promising candidate for further research and development.</p>

<p>The TRPC6 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has various applications in research and diagnostics. This antibody specifically targets TRPC6, which is a fatty acid-activated cation channel involved in numerous physiological processes.</p>

<p>Mouse monoclonal KCNJ3 antibody</p>

<p>PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW</p>

<p>NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK</p>

<p>The metabolite of furazolidone-OVA</p>

<p>Mouse monoclonal GRIA3 antibody</p>

<p>Purified recombinant NBL1 protein (His tag)</p>

<p>ZNF286 antibody was raised in rabbit using the N terminal of ZNF286 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. Its efficacy has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The metabolism of this drug involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>SLC37A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD</p>

<p>Rabbit polyclonal BCAS2 antibody</p>

<p>PTK7 antibody was raised in Mouse using a purified recombinant fragment of human PTK7 expressed in E. coli as the immunogen.</p>

<p>The ARNT antibody is a valuable tool in the field of Life Sciences. It is widely used for transfer reactions and immunoassays. This antibody specifically targets anti-VEGF (Vascular Endothelial Growth Factor) and is available in both polyclonal and monoclonal forms. The ARNT antibody can be utilized for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Mouse monoclonal HBV Pres 1 antibody</p>

<p>Rabbit polyclonal VATPase G1 antibody (HRP)</p>

<p>SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND</p>

<p>KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG</p>

<p>Rabbit polyclonal OR13H1 antibody</p>

<p>Rabbit polyclonal RAB18 antibody</p>

<p>Rabbit polyclonal SELE antibody</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:<br>Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, the ultimate antituberculosis drug from the rifamycin class. This potent compound is specifically designed to combat tuberculosis infections with its strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it effectively inhibits bacterial growth, preventing transcription and replication. Tested on human erythrocytes using a patch-clamp technique, this active form has shown remarkable effectiveness. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it offers a comprehensive solution against Mycobacterium tuberculosis strains. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indox</p>

<p>C5ORF4 antibody was raised using the N terminal Of C5Orf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ</p>

<p>The E2F-1 antibody is a highly specific monoclonal antibody that targets the E2F-1 protein. This protein plays a crucial role in cell cycle regulation and is involved in various biological processes, such as cell proliferation, differentiation, and apoptosis. The E2F-1 antibody has been extensively used in research studies to investigate the function of E2F-1 and its interaction with other molecules.</p>

<p>ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII</p>

<p>C13ORF28 antibody was raised using the middle region of C13Orf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ</p>

<p>KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD</p>

<p>ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT</p>

<p>The OSR1 antibody is a highly specialized antibody that targets and neutralizes the protease activity of OSR1. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in the Life Sciences field. The OSR1 antibody can be used for various research purposes, including the study of interleukin-6 and glucagon signaling pathways. It can also be used in immunoassays and other experimental techniques that require the immobilization of OSR1 or related proteins. With its high specificity and effectiveness, the OSR1 antibody is an essential tool for researchers working in the fields of molecular biology, biochemistry, and immunology.</p>

<p>KRT4 antibody was raised in Rabbit using Human KRT4 as the immunogen</p>

<p>The HDAC6 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and inhibit the activity of histone deacetylase 6 (HDAC6). This antibody has been shown to effectively block the growth factor signaling pathways that are regulated by HDAC6, making it a valuable tool for studying the role of HDAC6 in various cellular processes.</p>