Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.129 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.742 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
E.Coli HCP Antibody
<p>Rabbit Anti-E.Coli Host Cell Protein (HCP) Antibody</p>Degré de pureté :Min. 95%TSH protein (> 95% pure)
<p>Purified native Human TSH protein (> 95% pure)</p>Degré de pureté :Min. 95%SMARCA3 antibody
<p>SMARCA3 antibody was raised in rabbit using the N terminal of SMARCA3 as the immunogen</p>Degré de pureté :Min. 95%Chicken anti Mouse IgG (FITC)
<p>Chicken anti Mouse IgG secondary antibody (FITC)</p>Degré de pureté :Min. 95%Duocarmycin tm
CAS :<p>Duocarmycin tm is a cytotoxic agent that inhibits the proliferation of tumor cells. It selectively binds to target tissue, where it blocks cell maturation and induces tumor vasculature collapse. This drug also exhibits significant cytotoxicity against cancer cells in cell culture and has been shown to be active against human ovarian carcinoma in mice. Duocarmycin tm has minimal toxicity and does not have any negative effects on the normal tissues in the body.</p>Formule :C25H23ClN2O5Degré de pureté :Min. 95%Masse moléculaire :466.9 g/molKIAA1199 antibody
<p>KIAA1199 antibody was raised in Rabbit using Human KIAA1199 as the immunogen</p>SSH3 antibody
<p>The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.</p>NCKIPSD antibody
<p>NCKIPSD antibody was raised in rabbit using the middle region of NCKIPSD as the immunogen</p>Degré de pureté :Min. 95%GPR15 antibody
<p>The GPR15 antibody is an active agent in the field of Life Sciences. It specifically targets a molecule called cortisol, which plays a crucial role in various physiological processes. This antibody has been shown to bind to cortisol with high affinity, allowing for the detection and measurement of cortisol levels in biological samples.</p>LGALS3BP antibody
<p>The LGALS3BP antibody is a monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets LGALS3BP, a protein involved in multiple cellular processes including cell signaling, immune response, and cancer progression.</p>STC2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>ATG10 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG10 antibody, catalog no. 70R-3584</p>Degré de pureté :Min. 95%Tropomyosin antibody
<p>The Tropomyosin antibody is a highly reactive monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the expression and localization of GFAP, which is an important marker for astrocytes. This antibody has been extensively validated and shown to have high affinity and specificity for GFAP. It can be used in various applications such as immunohistochemistry, western blotting, and ELISA. Additionally, the Tropomyosin antibody has potential diagnostic applications as it can be used to detect GFAP in human serum samples, making it a valuable tool for the development of diagnostic agents.</p>LPL antibody
<p>The LPL antibody is a growth factor that belongs to the class of antibodies. It is a monoclonal antibody that specifically targets androgen, collagen, low density lipoprotein (LDL), endothelial growth factors, nuclear proteins, fibronectin, and serum albumin binding. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. It can be used in research studies to investigate the role of specific proteins or molecules in cellular processes. Additionally, the LPL antibody has potential therapeutic applications in the development of targeted treatments for diseases related to dysregulation of these proteins or molecules. With its high specificity and affinity, this antibody offers great potential for advancing scientific research and improving healthcare outcomes.</p>ARNT antibody
<p>The ARNT antibody is a highly specific antibody that is used in various life sciences applications. It is commonly used in agglutination assays and antigen-antibody reactions to detect the presence of ARNT (Aryl hydrocarbon receptor nuclear translocator) protein. This antibody can be used with different sample types, including liver microsomes, to study the role of ARNT in protein kinase signaling pathways. Additionally, the ARNT antibody has been shown to interact with oncostatin and leukemia inhibitory factor, both of which are important factors in cell proliferation and differentiation. The use of this specific antibody allows for precise detection and analysis of ARNT protein levels, providing valuable insights into its functional role in various biological processes.</p>THRA antibody
<p>THRA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%FAM20C antibody
<p>FAM20C antibody was raised using the middle region of FAM20C corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY</p>Degré de pureté :Min. 95%CCBP2 antibody
<p>CCBP2 antibody was raised in rabbit using the N terminal of CCBP2 as the immunogen</p>Degré de pureté :Min. 95%C13ORF31 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf31 antibody, catalog no. 70R-4182</p>Degré de pureté :Min. 95%YHO-13351 free base
CAS :<p>YHO-13351 is a potent and selective activator of the TRPA1 ion channel. It has been shown to inhibit the activity of protein kinase C (PKC) and PKC-dependent phospholipase A2, which are enzymes that regulate inflammatory responses. YHO-13351 has also been shown to be an antagonist for the β2 adrenergic receptor. The high purity of this compound enables its use as a research tool in cell biology and pharmacology.</p>Formule :C26H33N3O4SDegré de pureté :Min. 95%Masse moléculaire :483.62 g/molHuman CD27 ELISA kit
<p>ELISA kit for detection of CD27 (TNFRSF7) in the research laboratory</p>Degré de pureté :Min. 95%MMP3 antibody
<p>The MMP3 antibody is a monoclonal antibody that specifically targets and binds to matrix metalloproteinase 3 (MMP3). MMP3 is an enzyme involved in the breakdown of collagen, which plays a crucial role in various physiological processes. This antibody has antiviral properties and can be used in research and diagnostic applications in Life Sciences.</p>Cyclin A1 antibody
<p>The Cyclin A1 antibody is a highly specialized monoclonal antibody that targets the protein Cyclin A1. This antibody has been extensively studied for its role in regulating cell growth and division. It has been shown to interact with various growth factors, including TGF-beta and androgen, forming a protein complex that influences cell cycle progression.</p>Degré de pureté :Min. 95%FKBPL antibody
<p>FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE</p>β 2 Microglobulin antibody (HRP)
<p>Beta-2 microglobulin antibody (HRP) was raised in rabbit using beta-2-microglobulin from human urine as the immunogen.</p>Influenza B antibody
<p>Influenza B antibody was raised in mouse using Influenza B as the immunogen.</p>IFN γ antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.</p>IP10 antibody
<p>IP10 antibody was raised in rabbit using highly pure recombinant murine IP-10 as the immunogen.</p>Degré de pureté :Min. 95%
