Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.129 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.742 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
LYVE1 antibody
<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>Degré de pureté :Min. 95%LDH antibody
<p>LDH antibody was raised in goat using full length lactate dehydrogenase protein isolated from rabbit muscle as the immunogen.</p>Degré de pureté :Min. 95%STAT6 antibody
<p>The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>S100 antibody
<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>Tetracaine HCL
<p>Tetracaine HCL (USP grade powder) chemical reference substance</p>Degré de pureté :Min. 95%Hemopexin antibody
<p>Hemopexin antibody was raised against Human Hemopexin.</p>Degré de pureté :Min. 95%PCMTD1 protein (His tag)
<p>Purified recombinant PCMTD1 protein (His tag)</p>Degré de pureté :Min. 95%RHBDD1 antibody
<p>The RHBDD1 antibody is a monoclonal antibody specifically designed to target insulin. It is commonly used in research and diagnostic applications for the detection and analysis of insulin levels. This antibody has been extensively validated using mass spectrometry methods and has shown high specificity and sensitivity in detecting insulin in various samples, including human serum. The RHBDD1 antibody is derived from a hybridoma cell line and is produced using recombinant human insulin as an antigen. Its unique binding properties enable accurate measurement of insulin levels, making it an essential tool in the field of Life Sciences. Whether you are studying hyperinsulinaemic hypoglycaemia or investigating insulin-related disorders, this mouse monoclonal antibody can provide reliable results. With its ability to recognize specific acid residues on insulin, the RHBDD1 antibody offers precise and consistent performance for insulin detection. Trust this high-quality antibody for your research needs and unlock new insights into the role of insulin in various physiological processes.</p>RAD17 antibody
<p>RAD17 antibody was raised in rabbit using residues 10-23 [STKRSLKKKKIRKI] of the S. pombe RAD17 75 kDA protein as the immunogen.</p>Degré de pureté :Min. 95%PTPMT1 antibody
<p>PTPMT1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%ZNF19 antibody
<p>ZNF19 antibody was raised using the N terminal of ZNF19 corresponding to a region with amino acids TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE</p>NGAL antibody
<p>The NGAL antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly employed in transfer reactions and immunoassays to detect and quantify NGAL (neutrophil gelatinase-associated lipocalin) levels in various biological samples. This antibody has also been investigated as a potential therapeutic agent, particularly as an anti-CD25 antibody drug for targeted therapy.</p>LCOR antibody
<p>LCOR antibody was raised in rabbit using the C terminal of LCOR as the immunogen</p>Degré de pureté :Min. 95%NR4A3 antibody
<p>NR4A3 antibody was raised using the middle region of NR4A3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN</p>UBE2L3 antibody
<p>UBE2L3 antibody was raised using the middle region of UBE2L3 corresponding to a region with amino acids WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQ</p>AMG PERK 44
CAS :<p>AMG PERK 44 is a cytosolic calcium ionophore that activates the phosphorylation of eukaryotic protein kinase C. It acts through a biomimetic mechanism to increase Ca2+ concentrations in cells, which leads to increased protein synthesis, autophagy, and cell death. AMG PERK 44 has been shown to be effective against cancer cells and HIV-infected lymphocytes. It has also been shown to inhibit the growth of human immunodeficiency virus (HIV) infected cells by targeting the endoplasmic reticulum and increasing the levels of cytoplasmic Ca2+.</p>Formule :C34H29ClN4O2Degré de pureté :Min. 95%Masse moléculaire :561.1 g/molNSMCE1 antibody
<p>NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN</p>Goat anti Human IgG Fc (biotin)
<p>Goat anti-human IgG Fc (biotin) was raised in goat using human igG, Fc fragment as the immunogen.</p>RPL3 antibody
<p>RPL3 antibody was raised using the N terminal of RPL3 corresponding to a region with amino acids DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMV</p>Hepatitis C Virus antibody
<p>HCV antibody was raised in rabbit using residues 33-43 [CGVYLLPRRGPR] of HCV core, env, and part of E2/NS1 of HCV as the immunogen.</p>Degré de pureté :Min. 95%C10ORF57 antibody
<p>C10ORF57 antibody was raised using the middle region of C10Orf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH</p>Degré de pureté :Min. 95%CA13 protein
<p>CA13 protein is a conjugated protein that plays a role in various biological processes. It has been found to affect viscosity and antibody production. In particular, CA13 protein has been shown to inhibit interleukin-6 (IL-6), an inflammatory cytokine involved in immune responses. Studies have demonstrated its inhibitory factor on hemolysis and its potential applications in the field of Life Sciences. Monoclonal antibodies targeting CA13 protein have been developed for research purposes, allowing for the detection and neutralization of this protein in blood serum samples. Additionally, CA13 protein has been investigated for its impact on potassium levels in human serum and its interaction with recombinant viruses. Further research is being conducted to explore the potential therapeutic uses of CA13 protein in various diseases, including those related to TNF-α signaling pathways.</p>Degré de pureté :Min. 95%β Amyloid antibody
<p>The Beta Amyloid antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody is specifically designed to target and bind to beta amyloid, a protein that plays a crucial role in the development and progression of Alzheimer's disease. By binding to beta amyloid, this antibody inhibits its aggregation and promotes its clearance from the brain.</p>Degré de pureté :Min. 95%PAI1 antibody
<p>PAI1 antibody was raised in rabbit using highly pure recombinant human PAI-1 as the immunogen.</p>Degré de pureté :Min. 95%Clostridium difficile Toxin B protein
<p>Clostridium difficile Toxin B protein is a potent protein that plays a crucial role in the pathogenesis of Clostridium difficile infection. It is involved in disrupting the integrity of the intestinal epithelial barrier and causing severe inflammation. The toxin binds to specific receptors on the cell surface, leading to the activation of various signaling pathways and the release of pro-inflammatory cytokines such as interleukin-6.</p>Degré de pureté :Min. 95%EFNB2 antibody
<p>The EFNB2 antibody is a medicinal product that falls under the category of Life Sciences. It is an antibody that specifically targets and inhibits the activity of EFNB2 protein. This antibody is known as a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes on the target protein. The EFNB2 antibody has been extensively studied and proven to be effective in various research applications within the field of Life Sciences. Its high specificity and affinity make it a valuable tool for scientists and researchers working in this area. With its ability to selectively bind to EFNB2 protein, this antibody opens up new possibilities for understanding its role in biological processes and developing therapeutic interventions.</p>Cathepsin G antibody
<p>The Cathepsin G antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It offers exceptional photostability and cytotoxic properties, making it ideal for various research applications. This antibody targets the cycloalkyl group found in growth factors and polymerase enzymes, including EGF-like proteins.</p>
