Produits biochimiques et réactifs

<p>Rabbit polyclonal TBCB antibody</p>

<p>MSH2 antibody was raised in Mouse using a purified recombinant fragment of human MSH2 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Twf1 antibody, catalog no. 70R-9403</p>

<p>IFNA13 antibody was raised in rabbit using the C terminal of IFNA13 as the immunogen</p>

<p>KIF1A antibody was raised using the N terminal of KIF1A corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH</p>

<p>Purified recombinant Human EDF1 protein</p>

<p>Purified native Feline Infectious peritonitis protein</p>

<p>Affinity purified Rabbit polyclonal UKHC antibody</p>

<p>C17ORF80 antibody was raised using the N terminal Of C17Orf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP</p>

<p>4-(5-Pyridin-4-yl-1,3,4-oxadiazol-2-yl)pyridine-2-carbonitrile is a potent and selective inhibitor of the human peptidylprolyl isomerase B (PPIB), which is a key enzyme in protein folding. 4-(5-Pyridin-4-yl-1,3,4-oxadiazol-2-yl)pyridine - 2 - carbonitrile has been used as a research tool for studying PPIB's function in the cell. It has also shown to be an activator of the A2A receptor and ligand for the A3 receptor.</p>

<p>Rabbit polyclonal STARD8 antibody</p>

<p>(±)-WS 75624b is a potent and selective activator of the human serotonin 5-HT2C receptor. The binding affinity of (±)-WS 75624b to the human serotonin 5-HT2C receptor was determined by measuring the Ki value with radioligand binding assays using [3H]-mesulergine as the radioligand. The Ki value for (±)-WS 75624b was determined to be 0.8 nM, which is in good agreement with the Ki values reported for other serotonin 5-HT2C receptor agonists.</p>

<p>APOL5 antibody was raised in rabbit using the C terminal of APOL5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GGT2 antibody, catalog no. 70R-8808</p>

<p>DVL2 antibody was raised in Rabbit using Human DVL2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal GPRC6A antibody</p>

<p>Purified native Mouse IgG2b protein</p>

<p>TIE1 antibody was raised in rabbit using a 20 amino acid peptide of human TIE1 as the immunogen.</p>

<p>The MKK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to alpha-fetoprotein, a glycoprotein that plays a crucial role in various biological processes. This antibody can be used in a variety of assays, including immunohistochemistry and Western blotting, to detect and quantify the presence of alpha-fetoprotein in samples.</p>

<p>Purified recombinant SVIP protein (His tag)</p>

<p>The NFKB1 antibody is a highly specialized protein that belongs to the Life Sciences category. It is a monoclonal antibody that specifically targets and interacts with the NFKB1 protein. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN32 antibody, catalog no. 70R-1910</p>

<p>Rabbit polyclonal MYH15 antibody</p>

<p>Rubella virus antibody (FITC) was raised in goat using Rubeola strain HPV77 as the immunogen.</p>

<p>Rabbit polyclonal ZNF24 antibody</p>

<p>Rabbit polyclonal PM20D2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD2B antibody, catalog no. 70R-2881</p>

<p>FMOD antibody was raised in Rabbit using Human FMOD as the immunogen</p>

<p>Rabbit Polyclonal JunD antibody (Ser255)</p>

<p>The Cathepsin D antibody is a highly effective polyclonal antibody that is used in the field of life sciences. It acts as a CDK4/6 inhibitor and has been shown to inhibit p38 MAPK activation. This antibody is derived from human serum and contains excipients that enhance its stability and effectiveness. The Cathepsin D antibody specifically targets adipose tissue and globulin, making it an ideal tool for studying factors involved in adipose metabolism. Additionally, this antibody has anti-VEGF properties, neutralizing the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Its monoclonal nature ensures high specificity and reliability in experimental studies. With its ability to bind to specific acid residues, the Cathepsin D antibody can effectively block the activity of growth factors, providing valuable insights into cellular processes related to growth and development.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF700 antibody, catalog no. 70R-8989</p>

<p>EYA2 antibody was raised in rabbit using the middle region of EYA2 as the immunogen</p>

<p>C16ORF78 antibody was raised using the middle region of C16Orf78 corresponding to a region with amino acids GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PBEF1 antibody, catalog no. 70R-1027</p>

<p>The Connexin 43 antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets Connexin 43, a protein that plays a crucial role in cell communication. This antibody can be used to study the function and localization of Connexin 43 in various biological systems.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TTC6 antibody, catalog no. 70R-2757</p>

<p>Mouse monoclonal alpha beta TcR antibody (biotin)</p>

<p>Ret antibody was raised in Mouse using a purified recombinant fragment of Ret (aa896-1063) expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal Myotubularin related protein 4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABHD13 antibody, catalog no. 70R-6377</p>

<p>SUMO3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF</p>

<p>Rabbit anti-human IgA was raised in rabbit using human IgA alpha heavy chain as the immunogen.</p>

<p>Mouse monoclonal IgG2b Isotype Control Fc fusion protein (FITC)</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.</p>

<p>Purified recombinant Human TXNL1 protein</p>

<p>EIF2S3 antibody was raised in Rabbit using Human EIF2S3 as the immunogen</p>

<p>The hnRNP A1 antibody is a highly activated antibody that possesses protease activity. It is widely used in the field of Life Sciences for various research purposes. This antibody specifically targets hnRNP A1, a glycoprotein involved in RNA processing and transport. The hnRNP A1 antibody can be used as an active agent in experiments to study the function and localization of hnRNP A1 within cells.</p>

<p>OVA conjugated SAH Hapten</p>

<p>LRRC59 antibody was raised using the N terminal of LRRC59 corresponding to a region with amino acids TKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKL</p>

<p>Rabbit polyclonal RBM4 antibody</p>