Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNGR2 antibody, catalog no. 70R-6322</p>

<p>Purified recombinant COMMD9 protein (His tag)</p>

<p>Rabbit polyclonal PIP5K antibody</p>

<p>Purified recombinant Human RAP1A protein</p>

<p>TNFAIP8L1 antibody was raised using the middle region of TNFAIP8L1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL</p>

<p>Purified recombinant DTD1 protein</p>

<p>LAT3 antibody is a monoclonal antibody that is used as a medicament in the field of Life Sciences. It specifically targets arginase, an enzyme involved in the metabolism of arginine. By blocking the activity of arginase, LAT3 antibody helps to regulate the levels of arginine in the body, which can have various biochemical effects. This antibody has been extensively studied and characterized using hybridoma cell lines and isolated nucleic acids. It has shown high affinity for its target and exhibits excellent specificity for human proteins. LAT3 antibody is widely used in research laboratories and pharmaceutical companies for a variety of applications, including protein analysis, immunohistochemistry, and drug development. Whether you need a monoclonal or polyclonal antibody, LAT3 antibody is a reliable choice that delivers consistent results.</p>

<p>The CADM1 antibody is a high-quality antibody used in various immunocytochemical studies. It specifically targets the human protein CADM1, which plays a crucial role in cell adhesion and signaling. This antibody is produced using recombinant protein technology, ensuring its specificity and reliability.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PINX1 antibody, catalog no. 70R-2144</p>

<p>The Raf1 antibody is a polyclonal antibody that specifically targets the Raf1 protein. It is commonly used in the field of life sciences for research purposes. The Raf1 protein plays a crucial role in cell signaling pathways, particularly in the regulation of cell growth and differentiation. This antibody can be used to detect and quantify the expression levels of Raf1 in various samples, such as serum or tissue extracts. It is highly specific and sensitive, making it a valuable tool for studying the function and activity of Raf1 in different biological processes. Researchers often rely on this antibody to investigate the involvement of Raf1 in diseases like cancer, cardiovascular disorders, and neurological conditions. Its high affinity for the target antigen ensures accurate and reliable results, making it an essential component in many scientific studies.</p>

<p>MAPK6 antibody was raised in Rabbit using Human MAPK6 as the immunogen</p>

<p>BAK1 antibody was raised in mouse using recombinant human BAK1 (29-187aa) purified from E.coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rerg antibody, catalog no. 70R-9848</p>

<p>The SOX17 antibody is a highly specialized monoclonal antibody that targets the HER2 protein. It works by binding to β-catenin, a protein involved in cell signaling pathways, and inhibiting its function. This antibody has been extensively tested and has shown excellent results in low-density lipoprotein (LDL) receptor-deficient mice. Additionally, it has been found to have synergistic effects when used in combination with other therapeutic agents such as interferon, caffeine, transferrin, and trastuzumab.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ10490 antibody, catalog no. 70R-9475</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B3 antibody, catalog no. 70R-4646</p>

<p>LYZL4 antibody was raised in Rabbit using Human LYZL4 as the immunogen</p>

<p>Hamster RBC antibody (FITC) was raised in rabbit using hamster erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal SCAMP2 antibody</p>

<p>PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6276</p>

<p>The RAC1 antibody is a monoclonal antibody that specifically targets the RAC1 protein complex. This antibody has a high affinity for RAC1 and can neutralize its activity. It is formulated with excipients such as globulin to ensure stability and effectiveness. The RAC1 antibody belongs to the family of Polyclonal Antibodies, which are widely used in Life Sciences research. It can be used as an antigen in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody is particularly useful for studying the role of RAC1 in cell growth, as well as its interaction with other proteins such as growth factors and mineralocorticoid receptors. Additionally, it has been shown to have low cross-reactivity with other proteins or lipoproteins. Researchers and scientists can rely on the high quality and specificity of this RAC1 antibody for their experiments and studies.</p>

<p>CDC5L antibody was raised in Rabbit using Human CDC5L as the immunogen</p>

<p>The HSPA9 antibody is a powerful tool in the field of Life Sciences. It targets the HSPA9 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research related to epidermal growth factor, erythropoietin, e-cadherin, ketanserin, trastuzumab, and anti-HER2 antibody.</p>

<p>Rabbit polyclonal MCSFR antibody (Tyr723)</p>

<p>KIF3A antibody was raised in Rabbit using Human KIF3A as the immunogen</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH</p>

<p>CCNB1 antibody was raised in Rabbit using Human CCNB1 as the immunogen</p>

<p>HSPA9 antibody was raised in rabbit using the C terminal of HSPA9 as the immunogen</p>

<p>KCTD10 antibody was raised using the middle region of KCTD10 corresponding to a region with amino acids EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI</p>

<p>Rabbit polyclonal PSMA6 antibody</p>

<p>Rabbit polyclonal OSGIN1 antibody</p>

<p>Rabbit polyclonal DJ1 antibody (FITC)</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>Recombinant human MYL5 protein</p>

<p>The SERPINB2 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of human serum, including fatty acid metabolism, glutamate signaling, growth factors, and angiogenesis. This monoclonal antibody has been specifically designed to target and bind to SERPINB2, a protein involved in regulating several important biological processes.</p>

<p>Rabbit polyclonal RANK antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALOX12 antibody, catalog no. 70R-3235</p>

<p>IMMT antibody was raised in Rabbit using Human IMMT as the immunogen</p>

<p>The TIM antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which plays a crucial role in cell proliferation and differentiation. The TIM antibody can be used in research related to heparin-induced thrombocytopenia, where it helps in identifying and studying the mechanisms involved in this condition.</p>

<p>The Alkaline Phosphatase antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to alkaline phosphatase, an enzyme that plays a crucial role in various biological processes. By targeting alkaline phosphatase, this antibody can be used to study its function and localization in different tissues and cell types.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA4 antibody, catalog no. 70R-4207</p>

<p>CEBPZ antibody was raised in rabbit using the middle region of CEBPZ as the immunogen</p>

<p>Rabbit polyclonal ACV1B antibody</p>

<p>Affinity purified Rabbit polyclonal MEL1AR antibody</p>

<p>Mouse monoclonal PIP4K2A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-1369</p>