Produits biochimiques et réactifs

<p>CD100 antibody was raised in rabbit using residues 147-158 [GKNEDGKGRCPF] of the human CD100 protein as the immunogen.</p>

<p>The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.</p>

<p>(R)-Sertaconazole is a crystalline polymorph of sertaconazole, an antifungal drug. The polymorphs of sertaconazole are important diagnostic agents for the identification of fungal infections. (R)-Sertaconazole has also been shown to have anti-fungal and antimicrobial properties against human pathogens such as Candida species, Cryptococcus neoformans, and Aspergillus fumigatus. The most effective form of treatment for these infections is in the form of dry powders containing (R)-sertaconazole. These powders are inhaled by humans to treat respiratory diseases caused by these fungi.</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT</p>

<p>N-(1-((2-(dimethylamino)ethyl)amino)-2-methyl-1-oxopropan-2-yl)-4-(4-(2-methyl-5-(3,4,5-trihydroxytetrahydrofuran -2-yl)benzyl)phenyl)butanamide is a peptide activator of the human ion channel TRPM8. This peptide has been shown to inhibit the binding of a ligand (AITC) to the human receptor hM3Dq and to activate TRPM8 channels in rat dorsal root ganglion neurons. It has also been shown that this peptide can modulate the activity of voltage gated sodium channels.</p>

<p>CANX antibody was raised in rabbit using the C terminal of CANX as the immunogen</p>

<p>The CD34 antibody is a growth factor that plays a crucial role in microvessel density. This antibody is buffered and colloidal, making it ideal for use in various applications within the Life Sciences field. It is classified as a monoclonal antibody, which means it specifically targets a biomolecule of interest. The CD34 antibody has neutralizing properties and can be used as an immunosuppressant in certain cases. Its effectiveness can be measured through techniques such as electrophoresis and immunoassays. Additionally, this monoclonal antibody has been shown to interact with calmodulin, further highlighting its versatility and potential applications.</p>

<p>Rabbit polyclonal TMEM175 antibody</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>The West Nile virus antibody is a highly effective neutralizing agent that can be used for the detection and treatment of West Nile virus infections. It has been shown to bind to specific viral proteins, preventing the virus from entering host cells and replicating. This antibody is produced using advanced monoclonal antibody technology, ensuring high specificity and potency. In addition to its antiviral properties, this antibody has also been demonstrated to have other beneficial effects. It can activate various immune responses, such as chemokine production and fibrinogen activation, which are essential for controlling viral infections. Furthermore, it has been found to have potential therapeutic applications in the treatment of certain cancers, as it exhibits anti-mesothelin and alpha-fetoprotein activities. With its wide range of applications in both diagnostics and therapeutics, this West Nile virus antibody is an invaluable tool in the field of life sciences.</p>

<p>Purified recombinant REXO1 protein (His tag)</p>

<p>The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.</p>

<p>(S)-(-)-pH-797804 is a monoclonal antibody that blocks the receptor for tumor necrosis factor-alpha (TNFα) and is used to treat cancer. It has been shown to have anti-inflammatory effects in animal models of inflammatory bowel disease, arthritis, and colitis. This drug can be administered by intravenous injection or as an injection given directly into the tumor. The most common side effect is low blood pressure, which may require treatment with other medications.</p>

<p>Purified Native Bordetella pertussis toxin protein</p>

<p>GJA3 antibody was raised in Rabbit using Human GJA3 as the immunogen</p>

<p>PF 04991532 is a cyclopentyl compound that has been shown to have antiviral activity against HIV-1 and hepatitis C virus (HCV) in vitro. It also inhibits the production of inflammatory cytokines such as TNF-α and IL-6, and prevents HCV infection by blocking the interaction of Toll-like receptor 4 with its ligand. PF 04991532 also has an effect on axonal growth in rats with hepatic steatosis. PF 04991532 is administered orally, at a dose of 10 mg/kg once daily for 28 days. This treatment was found to be safe and well tolerated. There were no significant changes in pharmacokinetic parameters between the treatment group and the placebo group. The drug is not metabolized by cytochrome P450 enzymes, but it undergoes glucuronidation after being metabolized by other enzymes, resulting in a glucuronide conjugate (PF04991532-G).</p>

<p>7β-Eplerenone is a synthetic steroidal compound with high purity and a molecular weight of 362.6. It is used as a research tool in the field of cell biology, pharmacology, and receptor ligand interactions. This product is an activator of the nuclear receptor, which regulates gene transcription and protein synthesis. 7β-Eplerenone has been shown to inhibit the production of inflammatory cytokines such as tumor necrosis factor alpha (TNF-α) by binding to its receptors on cells. This product also inhibits ion channels such as calcium channels that are involved in neuronal transmission and muscle contraction.</p>

<p>Rabbit polyclonal Collagen XII alpha 1 antibody</p>

<p>CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM</p>

<p>9-[(4aR,6R,7R,7aS)-7-hydroxy-2-oxido-2-sulfanylidene-4a,6,7,7a-tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl]-2amino -8bromo-5H-purin-6one is a peptide that can be used as a research tool for studying protein interactions and ligand binding. 9-[(4aR,6R,7R,7aS)-7hydroxy 2oxido 2sulfanylidene 4a 6 7 7atetrahydro 4h fur 3 2 d 1 3 2 dioxaphosphinin 6yl] 2amino 8bromo 5h purin 6one has a high purity and is an inhibitor of ion channels.</p>

<p>FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI</p>

<p>PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE</p>

<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR</p>

<p>RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP</p>

<p>Inhibitor of Aurora A kinase</p>

<p>LY 2087101 is a selective α7 nicotinic acetylcholine receptor (α7NAChR) agonist that has been shown to have therapeutic potential in the treatment of inflammatory diseases, such as rheumatoid arthritis. LY 2087101 binds to the α7NAChR and stimulates it, leading to the release of dopamine. This drug has been found to be beneficial in alleviating psychotic disorders and may be useful in treating nicotine addiction. LY 2087101 also blocks cation channels that are associated with pain and inflammation. This drug has been shown to selectively activate specific types of α7 NAChRs, which can be used as a pharmacological probe for studying their role in physiological processes. LY 2087101 has good pharmacokinetic properties and an oral bioavailability of &gt;90%. It is eliminated by hepatic metabolism via cytochrome P450 enzymes, primarily CYP3A4, with a half-life of approximately 20 hours.</p>

<p>Rabbit polyclonal REX4 antibody</p>

<p>Rabbit polyclonal VEGFC antibody (HRP)</p>

<p>Rabbit polyclonal Chk2 antibody (Thr383)</p>

<p>Agonist of α7-nicotinic acetylcholine receptor</p>

<p>MJN228 is an experimental drug that binds to a specific site on the protein. It is being developed as a potential treatment for obesity, diabetes, and other metabolic diseases. MJN228 has been shown to bind to lipids, which are fatty molecules that are important in metabolism. Binding of MJN228 to these lipids may alter the way they interact with proteins.</p>

<p>Rabbit polyclonal URB1 antibody</p>

<p>Please enquire for more information about Triphenyl[2-(pyrrolidin-1-yl)ethyl]phosphanium bromide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal VPS26A antibody</p>

<p>Rabbit polyclonal HMGB1 antibody (FITC)</p>

<p>Kauniolide is a sesquiterpene lactone that is isolated from the roots of Costus speciosus. It has been shown to have anti-cancer properties and may be used for the treatment of cancer. Kauniolide blocks membrane transporters and induces membrane accumulation of cholesterol, which leads to cell death. It also inhibits the metabolism of cholesterol in cancer cells, leading to an increase in cellular levels of cholesterol and inhibition of protein synthesis. Kauniolide has been shown to be active against leukemia and breast cancer cells. Its mechanism of action is not well understood but it is postulated that its stereoselective nature may play a role in its anticancer effects.</p>

<p>Mouse monoclonal ERCC4 antibody</p>

<p>ZNF365 antibody was raised in rabbit using the N terminal of ZNF365 as the immunogen</p>

<p>18:1 Pi(4)P is a research tool that has been used to study the effects of phospholipids on ion channels and receptors. The compound is an inhibitor of ligand-gated ion channels, such as nicotinic acetylcholine receptors and glycine receptors. It has also been shown to interact with peptides and antibodies. 18:1 Pi(4)P is not expected to have any adverse side effects, but it should be handled with care because it is a potent cytotoxic agent.</p>

<p>5-Chloro-2-(4-fluorophenyl)-4-methyl-6-[3-(1-piperidinyl)propoxy]pyrimidine is a research tool that is used as an activator and ligand for various receptors. It has been shown to activate ion channels, such as calcium channels and sodium channels, and inhibit antibody production. This drug also binds to the extracellular domain of Ligand Receptor Complexes (LRCs) and inhibits cell proliferation by inhibiting protein synthesis. 5-Chloro-2-(4-fluorophenyl)-4-methyl-6-[3-(1-piperidinyl)propoxy]pyrimidine is a high purity compound with CAS No. 1639220–17–9.</p>

<p>The 4EBP1 antibody is a polyclonal antibody that belongs to the class of drug antibodies. It is widely used in life sciences research as an inhibitor and neutralizing agent. This antibody specifically targets and binds to 4EBP1, a family of binding proteins involved in regulating protein synthesis. The 4EBP1 antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It is buffered and optimized for use in different experimental conditions. Whether you are studying interleukins, ranolazine, or other chimeric proteins, the 4EBP1 antibody is a valuable tool for detecting and analyzing activated proteins. With its high specificity and sensitivity, this monoclonal antibody ensures accurate and reliable results in your research experiments.</p>

<p>Inhibitor of O-methyl-transferases</p>

<p>Mouse monoclonal NTF3 antibody</p>

<p>Rabbit polyclonal TCF3 antibody</p>

<p>Retinoic acid receptor-​related orphan receptor (ROR) modulator</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>Lwh-63 is a monoclonal antibody that blocks the interaction of proteins. It has been shown to bind to peptides and inhibit the function of ion channels. Lwh-63 is a research tool for use in studies on cell biology, pharmacology, and receptor binding. The chemical name for Lwh-63 hydrochloride is 2-[1-(2-methoxyethoxy)ethyl]benzeneacetic acid, ethyl ester, monosodium salt (1:1). It has a molecular weight of 467.87 g/mol and CAS No. 276890-57-4.</p>

<p>GNG2 antibody was raised in Rabbit using Human GNG2 as the immunogen</p>

<p>Rabbit polyclonal TLP4 antibody</p>