Produits biochimiques et réactifs

<p>PPM1 (PP2A Methyltransferase) Monoclonal Antibody</p>

<p>TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE</p>

<p>TRAIL Receptor 2 antibody was raised in rabbit using residues 280-296 (EHLLEPAEAERSQRRRL) of the human TRAIL-R2/DR5 protein as the immunogen.</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>Purified recombinant NEURL2 protein (His tag)</p>

<p>The NTRK3 antibody is a highly specialized monoclonal antibody that targets the neurotrophic tyrosine kinase receptor 3 (NTRK3). This receptor plays a crucial role in neuronal development and function. The NTRK3 antibody binds to the receptor, inhibiting its activity and preventing downstream signaling pathways.</p>

<p>Rabbit polyclonal LAMB3 antibody</p>

<p>CD200R1 antibody was raised in rabbit using the N terminal of CD200R1 as the immunogen</p>

<p>The JAK2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes such as growth factor signaling and immune response. This antibody is particularly effective in research applications where the inhibition of JAK2 activity is desired.</p>

<p>The Cyclin D1 antibody is a highly specific monoclonal antibody that is used in flow immunoassays to detect and quantify the presence of Cyclin D1 in human serum samples. This antibody is widely used in Life Sciences research and has been proven to be a valuable tool for studying the role of Cyclin D1 in various biological processes.</p>

<p>The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.</p>

<p>1-196 amino acids: MKVAKDLVVS LAYQVRTEDG VLVDESPVSA PLDYLHGHGS LISGLETALE GHEVGDKFDV AVGANDAYGQ YDENLVQRVP KDVFMGVDEL QVGMRFLAET DQGPVPVEIT AVEDDHVVVD GNHMLAGQNL KFNVEVVAIR EATEEELAHG HVHGAHDHHH DHDHDGCCGG HGHDHGHEHG GEGCCGGKGN GGCGCH</p>

<p>SLC26A8 antibody was raised using the C terminal of SLC26A8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV</p>

<p>The ADAM10 antibody is a highly specialized cytotoxic antibody that targets the tyrosine protease ADAM10. It is widely used in Life Sciences research, particularly in immunohistochemistry studies. This polyclonal antibody has been shown to inhibit the activity of ADAM10, which plays a crucial role in various cellular processes such as interleukin-6 and insulin signaling. The ADAM10 antibody is commonly used as a tool to study the function of this protein and its involvement in disease pathways. Researchers also use monoclonal antibodies against ADAM10 for specific applications, such as insulin or interleukin detection. Additionally, this antibody has potential therapeutic applications due to its ability to modulate ADAM10 activity and downstream effects on cellular processes. Its specificity and high affinity make it an essential tool for studying the biology of ADAM10 and its associated pathways.</p>

<p>Purified recombinant Human GUK1 protein</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>SLC1A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKES</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDR-O antibody, catalog no. 70R-4417</p>

<p>Rabbit polyclonal CCL24 antibody (FITC)</p>

<p>The WDR45 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor. It specifically binds to tyrosine residues on the receptor, inhibiting its activity and preventing the binding of growth factors. This antibody has shown promising results in the field of Life Sciences, particularly in the treatment of autoimmune disorders and cancer.</p>

<p>Rabbit polyclonal GPR139 antibody</p>

<p>The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.</p>

<p>Rabbit polyclonal Lactadherin antibody (HRP)</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>The ARAF antibody is a growth factor that has been extensively studied in the field of Life Sciences. It is a monoclonal antibody that specifically targets ARAF, a protein involved in cell signaling pathways. This antibody has shown cytotoxic activity when used as a conjugate with anti-CD20 antibodies, making it a promising candidate for targeted therapy in certain types of cancer. The ARAF antibody has undergone rigorous glycosylation analysis to ensure its stability and efficacy in human serum. Additionally, it has been found to inhibit the activity of epidermal growth factor (EGF) and other EGF-like proteins, further highlighting its potential therapeutic applications. Whether you're looking for antibodies for research purposes or seeking inhibitors for specific targets, the ARAF antibody offers a valuable tool in the field of Life Sciences.</p>

<p>Kallikrein 2 Monoclonal Antibody (HRP)</p>

<p>The BRCA1 antibody is a biomolecule commonly used in the Life Sciences field. It is water-soluble and can be used as both a polyclonal and monoclonal antibody. This antibody specifically targets BRCA1, a protein involved in DNA repair and cell growth regulation. It is often used to study the expression levels and localization of BRCA1 in various tissues and cell types.</p>

<p>Rat monoclonal CD115 antibody (allophycocyanin)</p>

<p>GUCA1A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK</p>

<p>CD19 antibody was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW</p>

<p>Purified Polyclonal PEX14 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA5 antibody, catalog no. 70R-2827</p>

<p>ITK antibody was raised in Mouse using a purified recombinant fragment of ITK(aa2-110) expressed in E. coli as the immunogen.</p>

<p>The RPE antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the interleukin-6 (IL-6) protein and is widely used in studies related to exocytosis and nuclear processes. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT</p>

<p>The BTK antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is primarily used to target and inhibit Bruton's tyrosine kinase (BTK), an enzyme that plays a crucial role in cell signaling pathways. The BTK antibody has been extensively studied for its ability to block the growth of hepatocytes and epidermal cells, making it a valuable tool in research and therapeutic applications.</p>

<p>Mouse monoclonal PARP16 antibody</p>

<p>Rabbit polyclonal CTNNB1 antibody (HRP)</p>

<p>Rabbit polyclonal B3GALT2 antibody</p>

<p>The beta hCG antibody is a glycoprotein that is produced by a hybridoma cell strain. It is commonly used in Life Sciences research for various applications, including immunoassays and antigen-antibody reactions. This antibody specifically targets beta human chorionic gonadotropin (hCG), which is a hormone produced during pregnancy.</p>

<p>Rabbit polyclonal FUCA2 antibody</p>

<p>Recombinant Human QTRT1 protein with His tag</p>

<p>MPV17 antibody was raised in Rabbit using Human MPV17 as the immunogen</p>

<p>ACTB antibody was raised in mouse using recombinant Human Beta Actin</p>

<p>The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.</p>

<p>NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLAGL1 antibody, catalog no. 20R-1207</p>

<p>SULT1E1 antibody was raised using the middle region of SULT1E1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY</p>

<p>Rabbit Polyclonal STAT4 antibody (Tyr693)</p>