Produits biochimiques et réactifs

<p>MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK</p>

<p>The Rb antibody is a monoclonal antibody that specifically targets and binds to the Rb protein. This antibody is widely used in various assays and research applications in the field of Life Sciences. It has been extensively validated for use in nuclear staining, immunohistochemistry, and Western blotting. The Rb antibody offers high sensitivity and specificity, making it an ideal tool for studying the expression and localization of Rb protein in different tissues and cell types. Additionally, this antibody has been successfully used in studies involving human serum markers such as histamine, erythropoietin, sclerostin, glp-1, and human chorionic gonadotropin. With its superior performance and reliability, the Rb antibody is a valuable asset for researchers looking to unravel the intricate mechanisms underlying various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDO antibody, catalog no. 70R-10284</p>

<p>The TAU antibody is a highly specialized monoclonal antibody that targets the growth factor known as acetylcholine. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It specifically binds to interferon-gamma (IFN-gamma) and inhibits its activity, leading to a decrease in the production of chemokines and other inflammatory mediators.</p>

<p>The DBH antibody is a glycopeptide that belongs to the class of polyclonal antibodies. It specifically targets and binds to the glycoprotein known as dopamine beta-hydroxylase (DBH). DBH is an enzyme that plays a crucial role in the conversion of dopamine to norepinephrine, making it essential for proper neurotransmitter function.</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Affinity purified Rabbit polyclonal L xylulose reductase antibody</p>

<p>The FKBP1A protein is a versatile and important component in various biochemical processes. It can be used in research, diagnostics, and therapeutic applications. This protein has been extensively studied and characterized for its role in protein folding, cellular signaling, and immune response regulation.</p>

<p>Mafk antibody was raised in rabbit using the N terminal of Mafk as the immunogen</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CISD2 antibody, catalog no. 70R-6583</p>

<p>Recombinant Human MRPL48 protein</p>

<p>KRT18 antibody was raised in mouse using recombinant human KRT18 (79-430aa) purified from E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it possesses strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA</p>

<p>TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogen</p>

<p>The Chk1 antibody is a powerful tool in the field of molecular biology and research. This antibody specifically targets and binds to the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. By inhibiting the activity of Chk1, this antibody can be used to study the effects of Chk1 inhibition on various cellular processes.</p>

<p>CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CASC3 antibody, catalog no. 70R-3212</p>

<p>Rabbit polyclonal VLDLR antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf3 antibody, catalog no. 70R-3270</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB38 antibody, catalog no. 70R-5865</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified Polyclonal FGF5 antibody</p>

<p>The SKP2 antibody is a highly specialized polyclonal antibody that targets the antigen binding domain of the SKP2 protein. It plays a crucial role in regulating cell cycle progression and has been implicated in various diseases, including cancer. This antibody can be used for a wide range of applications, such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Purified recombinant LGALS13 protein (His tag)</p>

<p>SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA</p>

<p>GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA8 antibody, catalog no. 70R-2851</p>

<p>The AP2M1 antibody is an anticoagulant that is widely used in the field of Life Sciences. It specifically targets a virus surface antigen and has been shown to have neutralizing effects on the virus. This antibody can be immobilized on various surfaces, such as electrodes, for further study and analysis. In addition, the AP2M1 antibody has the ability to bind to fibrinogen, a key molecule involved in blood clotting. This makes it a valuable tool in research related to coagulation disorders and thrombosis. The AP2M1 antibody is available as a monoclonal antibody, derived from human serum, ensuring high specificity and reliability in experiments. Its carbonic 3-kinase activity further enhances its functionality and versatility in various applications within the field of Life Sciences.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth.</p>

<p>PLCG2 antibody is a polyclonal antibody that specifically targets the PLCG2 protein. PLCG2 is an enzyme involved in the production of second messengers, such as inositol trisphosphate (IP3) and diacylglycerol (DAG), which play important roles in cellular signaling pathways. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to be effective in detecting and quantifying PLCG2 expression levels in different tissues and cell types. The use of this antibody can provide valuable insights into the function and regulation of PLCG2, as well as its potential role in various diseases and conditions.</p>

<p>Rabbit polyclonal SNAP29 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STK32A antibody, catalog no. 70R-3604</p>

<p>ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RDBP antibody, catalog no. 70R-4630</p>

<p>LENG9 antibody was raised in Rabbit using Human LENG9 as the immunogen</p>

<p>Rabbit polyclonal Tau antibody (Ser519/202)</p>

<p>HK1 antibody was raised in rabbit using the N terminal of HK1 as the immunogen</p>

<p>Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>UCP1 antibody was raised in rabbit using a 12 amino acid peptide from mouse/rat UCP1 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DRAM antibody, catalog no. 70R-9619</p>

<p>The SLIT2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the mitogen-activated protein SLIT2, which plays a crucial role in cell growth and development. This antibody has been shown to inhibit the activity of SLIT2, making it an invaluable tool for studying the function of this growth factor.</p>

<p>Purified recombinant ZWINT protein (His tag)</p>

<p>GPR161 antibody was raised in Rabbit using Human GPR161 as the immunogen</p>

<p>Rabbit polyclonal PSMB11 antibody</p>

<p>The PYK2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the activity of the colony-stimulating factor (CSF) receptor known as PYK2. This antibody has been extensively tested and proven to effectively bind to PYK2, inhibiting its receptor binding and downstream signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM126A antibody, catalog no. 70R-10016</p>

<p>FAM119A antibody was raised using the middle region of FAM119A corresponding to a region with amino acids LGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVK</p>

<p>The GluR1 antibody is a polyclonal antibody that is used in Life Sciences research. It has been specifically designed to detect and bind to the GluR1 receptor, which is an ionotropic glutamate receptor involved in synaptic transmission. This antibody can be used in various applications, such as electrochemical impedance spectroscopy and transcription-polymerase chain reaction (PCR), to study the function and expression of the GluR1 receptor. Additionally, it can be used in agglutination assays to measure the interaction between the GluR1 receptor and other molecules, such as glycine or gamma-aminobutyric acid (GABA). The GluR1 antibody has high specificity and affinity for its target, making it a valuable tool for researchers studying neuronal signaling pathways and synaptic plasticity. Furthermore, this antibody has shown antioxidant activity and may have potential therapeutic applications in neurodegenerative diseases.</p>