Produits biochimiques et réactifs

<p>Purified Polyclonal Glycerol Kinase 2 antibody</p>

<p>Rabbit polyclonal YWHAB antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.</p>

<p>The Beta tubulin antibody is a monoclonal antibody that specifically targets the beta tubulin protein. This antibody has been widely used in research and diagnostics in the field of Life Sciences. It can be used to study various cellular processes, including cell division, intracellular transport, and cytoskeleton organization.</p>

<p>BDH1 antibody was raised in Rabbit using Human BDH1 as the immunogen</p>

<p>GJC1 antibody was raised using the middle region of GJC1 corresponding to a region with amino acids ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI</p>

<p>Purified Polyclonal GRB10 antibody</p>

<p>C14ORF101 antibody was raised in rabbit using the N terminal of C14ORF101 as the immunogen</p>

<p>Rabbit polyclonal CD18 antibody (Thr758)</p>

<p>Purified Rabbit polyclonal CDC16 antibody (Ser560)</p>

<p>The CD36 antibody is a highly specialized protein monoclonal antibody used in the field of Life Sciences. It specifically targets CD36, a cell surface receptor involved in various cellular processes. This monoclonal antibody has been extensively studied and validated for its specificity and effectiveness.</p>

<p>The Bax antibody is a highly effective monoclonal antibody that has neutralizing properties. It targets TRPV4, a protein involved in various cellular processes, and inhibits its activity. Additionally, the Bax antibody has been shown to neutralize TNF-α, a pro-inflammatory cytokine that plays a role in immune responses. This antibody is widely used in Life Sciences research and is an essential tool for studying TRPV4 and TNF-α related pathways. It can be utilized in various applications such as immunohistochemistry and endotoxemia studies. With its high specificity and potency, the Bax antibody is a valuable asset for researchers looking to investigate TRPV4 and TNF-α signaling pathways.</p>

<p>Mouse monoclonal Integrin alpha 3A antibody</p>

<p>1-673 amino acids: MGSSHHHHHH SSGLVPRGSH MAKPAQGAKY RGSIHDFPGF DPNQDAEALY TAMKGFGSDK EAILDIITSR SNRQRQEVCQ SYKSLYGKDL IADLKYELTG KFERLIVGLM RPPAYCDAKE IKDAISGIGT DEKCLIEILA SRTNEQMHQL VAAYKDAYER DLEADIIGDT SGHFQKMLVV LLQGTREEDD VVSEDLVQQD VQDLYEAGEL KWGTDEAQFI YILGNRSKQH LRLVFDEYLK TTGKPIEASI RGELSGDFEK LMLAVVKCIR STPEYFAERL FKAMKGLGTR DNTLIRIMVS RSELDMLDIR EIFRTKYEKS LYSMIKNDTS GEYKKTLLKL SGGDDDAAGQ FFPEAAQVAY QMWELSAVAR VELKGTVRPA NDFNPDADAK ALRKAMKGLG TDEDTIIDII THRSNVQRQQ IRQTFKSHFG RDLMTDLKSE ISGDLARLIL GLMMPPAHYD AKQLKKAMEG AGTDEKALIE ILATRTNAEI RAINEAYKED YHKSLEDALS SDTSGHFRRI LISLATGHRE EGGENLDQAR EDAQVAAEIL EIADTPSGDK TSLETRFMTI LCTRSYPHLR RVFQEFIKMT NYDVEHTIKK EMSGDVRDAF VAIVQSVKNK PLFFADKLYK SMKGAGTDEK TLTRIMVSRS EIDLLNIRRE FIEKYDKSLH QAIEGDTSGD FLKALLALCG GED</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>Rabbit polyclonal APTX antibody</p>

<p>PDE8B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal UBE2S antibody</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>C9orf156 antibody was raised in Rabbit using Human C9orf156 as the immunogen</p>

<p>TRIM63 antibody was raised using the middle region of TRIM63 corresponding to a region with amino acids EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ</p>

<p>Salazinic acid is a small molecule that has been shown to have pharmacological properties. Salazinic acid binds to the receptor site of ion channels and inhibits the activity of these channels. It also binds to peptide ligands, which are used in cell biology research as an inhibitor or activator of protein interactions. Salazinic acid is a high-purity reagent that can be used as a research tool for studying ion channels and antibody production.</p>

<p>GR 82334 is an experimental drug that acts as a 5-HT4 receptor agonist. It has been shown to be effective in animal experiments and in treating symptoms of autoimmune diseases. GR 82334 also has an inhibitory effect on platelet aggregation, which may be due to its ability to act as an anti-platelet agent by activating the 5-HT4 receptor. GR 82334 is also a diagnostic tool for Parkinson's disease, because it can induce Parkinsonian symptoms in animals and humans. This drug is being researched for other potential uses, such as its potential as a treatment for neurokinin-1 receptor (NK1R) related disorders such as migraine headaches.</p>

<p>Mouse monoclonal PRKAR2A antibody</p>

<p>Purified recombinant Human Hexokinase 4 protein</p>

<p>Less active isomer of latanoprost</p>

<p>Rabbit polyclonal LEMD1 antibody</p>

<p>Please enquire for more information about NPS-1034 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat monoclonal Ly6G antibody (PE)</p>

<p>YM-155 HCl is a peptide that inhibits the activity of the protein Interleukin-2 receptor (IL-2R) and its ligand, IL-2. YM-155 HCl is a research tool for studying IL-2R and IL-2 interactions. It can be used to study the role of IL-2 in cell biology, pharmacology, and life science. This inhibitor can also be used as a reagent for identifying IL-2R or IL-2 binding partners. YM-155 HCl has high purity with less than 1% impurities. It is an activator of ion channels and receptors.</p>

<p>The PAX2 antibody is a highly specific monoclonal antibody that recognizes and binds to the PAX2 protein. This antibody is commonly used in research and diagnostic applications to study the expression and function of PAX2 in various biological processes.</p>

<p>GLP-26 is a pegylated peptide that inhibits viral replication and has life-threatening treatments. GLP-26 is a modified version of the human growth hormone (hGH) with a 24 amino acid sequence. It has been shown to inhibit the replication of the Human Immunodeficiency Virus (HIV) in culture. GLP-26 is also being studied as a potential treatment for hepatitis C, with promising results in animal models. GLP-26 has been optimized by substituting serine residues with glycine residues, which may increase its stability and bioavailability.</p>

<p>The CYP4B1 antibody is a highly specialized monoclonal antibody that is commonly used in Life Sciences research. It is colloidal in nature and specifically targets the CYP4B1 protein. This monoclonal antibody has been extensively studied and proven to be effective in detecting and quantifying the presence of CYP4B1 in various biological samples.</p>

<p>Hantavirus (Puumala) antibody (HRP) was raised in mouse using recombinant Puumala nucleocapsid protein as the immunogen.</p>

<p>Rabbit polyclonal PR antibody (Ser400)</p>

<p>TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME</p>

<p>Purified recombinant TNFSF13 protein (T7 tag)</p>

<p>THRA antibody was raised in mouse using recombinant Human Thyroid Hormone Receptor, Alpha (Erythroblastic Leukemia Viral (V-Erb-A) Oncogene Homolog, Avian)</p>

<p>PPDA is a synthetic chemical compound, which is an aromatic amine derived from aniline through a series of chemical reactions involving nitration and reduction. Its mode of action involves acting as an intermediate or precursor in a variety of organic synthesis processes, playing a pivotal role in the formation of complex organic structures. PPDA's electrophilic properties make it an essential component in producing dyes, polymers, and pharmaceuticals by facilitating specific chemical transformations. Additionally, it demonstrates high reactivity in coupling reactions due to its amine group, enhancing its utility in the synthesis of polymers and advanced materials.</p>

<p>Caspase-3/7 Inhibitor I is a chemical compound used predominantly in biochemical research, particularly in the study of apoptosis. It is a synthetic, reversible inhibitor derived from known peptide inhibitors of caspase enzymes. The inhibitor functions by blocking the active sites of caspase-3 and caspase-7 enzymes, halting their protease activity, which is crucial in the execution phase of apoptosis.</p>

<p>The Pax5 antibody is a neutralizing monoclonal antibody that specifically targets the CD33 antigen. It acts as an inhibitor, blocking the activity of CD33 and preventing its interaction with other molecules. This antibody has been shown to be effective in neutralizing the effects of antiphospholipid antibodies, which are associated with autoimmune disorders. Additionally, it has been demonstrated to inhibit tyrosine phosphorylation and the activation of TRPV4 channels. The Pax5 antibody can be used for various applications, including immunohistochemistry and protein kinase studies. Its versatility and specificity make it a valuable tool for researchers in the field of immunology.</p>

<p>Recombinant Human AMPD2 protein</p>

<p>AP C5 is an antimicrobial peptide, which is a biologically-derived molecule with potent bactericidal properties. It originates from natural or synthetic sources, often designed to mimic peptides found in diverse organisms such as amphibians, insects, or mammals that possess innate immune responses.</p>

<p>Purified Polyclonal PRKAA1 antibody</p>

<p>Mouse monoclonal EPN2 antibody</p>

<p>The WNT1 antibody is a highly potent and specific monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to the WNT1 protein, which plays a crucial role in cellular signaling pathways. By binding to the WNT1 protein, this antibody can effectively inhibit its receptor binding activity, thereby disrupting the formation of protein complexes involved in cell growth and development.</p>

<p>The STK24 antibody is a highly specialized biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the STK24 protein, which is involved in various cellular processes such as growth factor signaling and actin filament organization. This antibody can be used in experiments to study the function and regulation of STK24, as well as its interactions with other proteins.</p>

<p>Psuedomonas polyclonal</p>

<p>Rabbit polyclonal TNFSF10 antibody (FITC)</p>

<p>The FSHR antibody is a neutralizing antibody that targets the follicle-stimulating hormone receptor (FSHR). It specifically binds to estrogen receptors and inhibits their activity. This antibody is commonly used in Life Sciences research to study hormone peptides, glycans, and tyrosine residues. It is available as both a monoclonal antibody and a polyclonal antibody.</p>