Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of CRLF1 antibody, catalog no. 70R-5737

POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen

Affinity purified Rabbit polyclonal GLYATL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Ttbk2 antibody, catalog no. 70R-8045

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX50 antibody, catalog no. 70R-1367

A synthetic peptide for use as a blocking control in assays to test for specificity of ECHDC2 antibody, catalog no. 70R-5270

CD45 antibody (Spectral Red) was raised in mouse using chicken CD45 as the immunogen.

CD62E antibody (PE) was raised in mouse using human CD62E/E-selectin as the immunogen.

CD45.2 antibody (PE-CY5.5) was raised in mouse using CD45.2 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SDF4 antibody, catalog no. 70R-7410

6-[2,5-Bis(trifluoromethyl)-3H-imidazo[4,5-b]pyridin-3-yl]-2(3H)-benzothiazolone is a novel small molecule that has been shown to be a potent and selective activator of the protein kinase C (PKC) family. It binds to the PKC alpha isoform with an IC50 of 0.5 nM and displays low nanomolar activity against PKC beta and gamma isoforms. The activation of PKC alpha by 6-[2,5-bis(trifluoromethyl)-3H-imidazo[4,5-b]pyridin-3-yl]-2(3H)-benzothiazolone leads to increased phosphorylation of proteins involved in cell signaling pathways, including G protein coupled receptors (GPCRs), tyrosine kinases and

Avex-73 is a chemical deterrent, which is derived from naturally occurring plant-based extracts. It operates by affecting the sensory pathways of birds, making treated areas undesirable for them through olfactory and gustatory discomfort. When applied, Avex-73 interacts with the specific chemosensory receptors present in avian species, creating an aversive, yet non-lethal reaction. This makes it an effective tool in managing bird-related challenges in various environments.

A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN32 antibody, catalog no. 70R-1884

A synthetic peptide for use as a blocking control in assays to test for specificity of PDE1A antibody, catalog no. 70R-9236

Camp-am is a progestin contraceptive medication that prevents pregnancy by interfering with the ovulation process. It has been demonstrated to have a damaging effect on the genus Campylobacter, which can cause gastrointestinal illness. This drug is also known to modulate blood glucose levels and tumorigenicity in mice. Camp-am has been shown to activate horse melanocytes and increase hyperactivity in rats. Camp-am also induces glioma in mice, although it does not have any harmful effects on other cells in vitro. Camp-am has been shown to be activated by reperfusion following treatment with hydrogen peroxide or lipid peroxidation inhibitors, but not by a variety of other agents such as light, heat, or oxygen radicals.

HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW8 antibody, catalog no. 70R-9336

Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.

Pentagamavunon-1 is an activator of the pentagamma subunit of the ligand-gated ion channel. It binds to the receptor and activates it, causing a change in the permeability of cells. Pentagamavunon-1 can be used as a research tool or as an inhibitor in cell biology.

Mouse monoclonal CD3 antibody (PE)

This Neuroendocrine Regulatory Peptide- 2 (human) product can be used as an endogenous suppressor of vasopressin release and is available as a 0.1mg vial. The neuroendocrine regulatory peptide-2 (NERP2) is derived from VGF and it colocalizes with vasopressin in the hypothalamus and it has been found that NERPs prevent vasopressin release from the hypothalamus. Thus NERP2 is involved in body fluid homeostasis through modulating the release of vasopressin.

Affinity purified Rabbit polyclonal CSDE1 antibody

4-[[3-Bromo-4-ethoxy-5-(4-methylbenzoyl)benzoyl]amino]benzoic acid is a research tool for the study of ion channels, ligands, and receptors. It is a potent inhibitor of potassium channels. The ligand has been shown to interact with the α1A subunit of the nicotinic acetylcholine receptor in an agonistic manner. In addition, 4-[(3-bromo-4-ethoxy-5-(4-methylbenzoyl)benzoyl)amino]-N-(1H-indol-3yl)benzoic acid has been shown to be an antagonist of voltage gated sodium channels.

BUB3 antibody was raised in Rabbit using Human BUB3 as the immunogen

The CD34 antibody is a highly specialized antibody that targets a specific cell antigen known as CD34. This antibody can be used in various applications within the Life Sciences field, particularly in the study of functional endothelial cells and microvessel density.

Mouse monoclonal PGAM2 antibody

RP 001 hydrochloride is a serotonin reuptake inhibitor that stabilizes blood pressure by inhibiting the s1p receptor. It also inhibits the reuptake of serotonin, which is an important neurotransmitter in the central nervous system. RP 001 hydrochloride has antioxidant effects and may be beneficial for people with high blood pressure, heart disease, or depression. This drug can be used to stabilize vascular function and prevent thrombosis by inhibiting platelet aggregation. It has been shown to have protective effects against vascular sclerosis and also increases the production of hyaluronic acid, which is a natural glycosaminoglycan found in synovial fluid.

Serotonin (5-HT1D) receptor antagonist

CD25 antibody (PE) was raised in rat using alpha chain IL-2 receptor as the immunogen.

3-(4-Bromo-3,5-dimethoxyphenyl)-2-(methoxymethyl)-2-propenenitrile-d6 is a research tool for receptor binding. It is a ligand that binds to the ion channels and may be an inhibitor of protein interactions. 3-(4-Bromo-3,5-dimethoxyphenyl)-2-(methoxymethyl)-2-propenenitrile-d6 is used in pharmacology and biochemistry as a ligand for the study of protein interactions. It has been used to characterize the structure and function of ion channels and antibodies. The chemical name is 3-(4-bromo-3,5-dimethoxyphenyl)-2-(methoxymethyl)propene nitrile d6 and it has CAS No. 56518-39-9.

CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of CHRND antibody, catalog no. 70R-8065

Affinity purified Rabbit polyclonal MAPK1 antibody

Rabbit polyclonal VTN antibody

PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.

CD45RB antibody (biotin) was raised in rat using cloned murine Th2 cell lines as the immunogen.

Rabbit polyclonal YME1L1 antibody

CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.

Ac-Val-Asp-Val-Ala-Asp-AMC is a research tool used to study the function of ion channels. It is an activator that binds to the receptor site on ATP sensitive potassium channels. Ac-Val-Asp-Val-Ala-Asp-AMC has been shown to inhibit calcium and sodium ion flux through ion channels, as well as high purity and good solubility. This peptide is useful for studying protein interactions, pharmacology, and life science research.

A synthetic peptide for use as a blocking control in assays to test for specificity of GRK7 antibody, catalog no. 70R-9903

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTL6B antibody, catalog no. 70R-3899

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. Extensive research has shown its high activity on human erythrocytes using the patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Des-Asp1-[Ile8]-Angiotensin II is a peptide that has been shown to have analgesic effects. It has been reported to be active in anesthetized, Sprague-Dawley rats and in primary cultures of rat brain neurons. The peptide binds to the angiotensin II type 1 receptor (AT1) subtype and enhances the activity of the receptor when it is bound by angiotensin II. Des-Asp1-[Ile8]-Angiotensin II also inhibits aminopeptidase activity, leading to an increase in the concentration of angiotensin II. This leads to increased antinociception at high concentrations, which may be due to its effect on baroreceptors or mesenteric blood vessels.

(2S,4R)-4-((3-Chloro-7-methoxyquinoxalin-2-yl)oxy)-2-(methoxycarbonyl)pyrrolidinium methanesulfonate is a peptide that can be used as a research tool to study protein interactions and receptor binding. It is an inhibitor of ion channels and ligand for G protein coupled receptors. The purity of this compound is >97%. CAS No. 1425038-20-5

Trofinetide is a neuroprotective compound that acts as an antioxidant. Trofinetide has been shown to reduce oxidative stress and protect against neuronal death in cells. It also has been shown to improve the clinical response in patients with Alzheimer's disease, and may be used for the treatment of other neurodegenerative disorders such as Parkinson's disease. Trofinetide is orally administered and is metabolized by cytochrome P450 enzymes, which makes it a suitable candidate for specific treatments. The pharmacokinetic properties of trofinetide are not well understood due to its short half-life.

The Lp-PLA2 monoclonal antibody is a powerful growth factor that targets specific proteins involved in the regulation of collagen and fatty acid metabolism. This antibody is designed to bind to Lp-PLA2, an enzyme responsible for the production of inflammatory mediators. By inhibiting this enzyme, the monoclonal antibody reduces inflammation and promotes healthy tissue repair.

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM35A antibody, catalog no. 70R-1019