Produits biochimiques et réactifs

<p>Peptide H-F^F^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NLQEINAYIGHSVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MVLASTTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-LAEYHAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The GAPDH protein is an antigen that is widely used in the field of Life Sciences. It has become a valuable tool for researchers due to its various applications. This protein can be used as an electrode in electrochemical experiments, allowing for the detection and quantification of specific molecules or compounds. Additionally, GAPDH can be targeted by antibodies, including monoclonal antibodies, which are commonly used in immunological studies. These antibodies can help identify and analyze the presence of GAPDH in different samples, such as human serum or tissue extracts. Furthermore, GAPDH plays important roles in cellular processes, including metabolism and energy production. It is involved in regulating glucose metabolism and has been shown to interact with molecules like glucagon, myostatin, and collagen. Overall, the versatile nature of GAPDH makes it a valuable asset for researchers in various fields of study within Life Sciences.</p>

<p>Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified native Human FABP protein (Cardiac)</p>

<p>Inhibitor of Flk-1/KDR receptor tyrosine kinases, a vascular endothelial growth factor receptor (VEGF) receptor expressed on precursor and mature forms of endothelial cells. SU 5416 also inhibits other tyrosine kinases, including c-KIT and FLT-3. Has therapeutic potential as an anti-angiogenic agent for the treatment of cancer.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.</p>

<p>Peptide H-SFIEDLLFNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>V5 Tag antibody was raised in mouse using GKPIPNPLLGLDST (V5) synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This product is an antiserum targeting amino acids 37-43 of the amyloid beta-protein which is a key component of extracellular plaques found in the brains of patients with Alzheimer’s disease (AD). It may also be involved in the pathogenesis of other neurodegenerative diseases such as Huntington’s disease and Parkinson’s disease. Targeting this protein may be key to drug discovery and the treatment of AD and other diseases this protein is associated with. Furthermore amyloid beta peptides located in the cerebrospinal fluid are well known biomarkers used to diagnose AD. Although AD is not yet curable, an early diagnosis can be useful in that patients can be treated to delay or improve symptoms.<br>This product may also be used to detect amyloid beta protein in cell cultures, tissues, or fluids by immunohistochemistry or ELISA. It is suitable for use in life sciences, cell biology, and pharmacology studies.</p>

<p>Purified recombinant FAM49B protein (His tag)</p>

<p>Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-QQKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat anti-cat IgG (H + L) (biotin) was raised in goat using feline IgG whole molecule as the immunogen.</p>

<p>Alkylating agent; cytotoxic; antineoplastic</p>

<p>Rhodamine antibody was raised in Mouse using This protein A purified monoclonal antibody was produced after repeated immunizations of balb/c mice with rhodamine conjugated KLH. as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-LLAFLQYRRLRKGYA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLAFLQYRRLRKGYA-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLAFLQYRRLRKGYA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLAFLQYRRLRKGYA-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Anti-Flt1 Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-DWSSWVYRDPQT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-EPDLWPRIPDDREDSC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-EPDLWPRIPDDREDSC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-EPDLWPRIPDDREDSC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-EPDLWPRIPDDREDSC-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-LFDSLTLLASGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.</p>

<p>Peptide H-LSITGTYDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Insulin receptor beta subunit antibody was raised in mouse using a 15-mer synthetic peptide corresponding to aa Tyr-KKNGILTLPRSNPS from the C-terminal of human insulin receptor beta-subunit as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>BSA antibody was raised in chicken using BSA as the immunogen.</p>

<p>Peptide 5Fam-VTSAPDTRPAPGSTAPPAHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TP-434 2HCl is a hydrochloride salt form of a novel synthetic compound. It is synthesized through a complex organic chemical process, exploiting cutting-edge methodologies to ensure high purity and effectiveness. The compound acts primarily by inhibiting specific bacterial enzymes critical to bacterial replication and survival, thereby exhibiting potent antimicrobial properties.</p>

<p>Peptide H-GGEIQPVSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-IQNTGDYYDLYGGEK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IQNTGDYYDLYGGEK-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IQNTGDYYDLYGGEK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IQNTGDYYDLYGGEK-OH at the technical inquiry form on this page</p>

<p>H-ETKPPLAPSSPPAPP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ETKPPLAPSSPPAPP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ETKPPLAPSSPPAPP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ETKPPLAPSSPPAPP-OH at the technical inquiry form on this page</p>