Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.115 produits)
- Par Biological Target(99.074 produits)
- Par usage/effets pharmacologiques(6.785 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.693 produits)
- Métabolites secondaires(14.219 produits)
130577 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-HKIHMGNRLTC-NH2
<p>Peptide Ac-HKIHMGNRLTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVVAPATDGGLNLTSTFLR^-OH
<p>Peptide H-SVVAPATDGGLNLTSTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYVSQFEGSAL^^GK-OH
<p>Peptide H-DYVSQFEGSAL^^GK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IDPNAWVER^-OH
<p>Peptide H-IDPNAWVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLGEISAASEFK^-OH
<p>Peptide H-GLGEISAASEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDHGAEIVYKSPVVSGDTSPR^-OH
<p>Peptide H-TDHGAEIVYKSPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYAASNLETGVPSR^-OH
<p>Peptide H-LLIYAASNLETGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAGVILAPLQR^-OH
<p>Peptide H-NAGVILAPLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Thymosin β-4 Heavy
<p>Thymosin β-4 (TB4) is an actin binding proteins (ABP), encoded by the TMSB4X gene and is regarded as the principal actin-sequestering protein in many cell types. TB4 is involved in maintaining sufficient amounts of intracellular monomeric actin that is readily available for use if needed. TB4 works by binding monomeric G-actin rendering it resistant to polymerisation into F-actin. TB4 is present in all cells except red blood cells and is located both in the cytoplasm and nucleus of the cell.TB4 is also involved in cell proliferation, migration, differentiation and tissue regeneration and may contribute to repair of human heart muscle damaged by heart disease and heart attack. TB4 reduces levels of inflammatory mediators, lowers reactive oxygen species, and up-regulates anti-oxidative enzymes, anti-inflammatory genes, and anti-apoptotic enzymes.The proline residue at position 4 of this peptide and the lysine residue at position 13 of this peptide are isotopically labelled with carbon-13 and nitrogen-15, giving this peptide a mass increase of 14 compared to the unlabelled peptide.</p>Degré de pureté :Min. 95%Masse moléculaire :1,525.8 g/molβ-MSH (human)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C118H174N34O35SMasse moléculaire :2,661 g/molH-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
<p>Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH
<p>Peptide 5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ara h 3 (278-284) peanut Allergen Heavy
<p>Ara h 3 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins. The Ara h 3 allergen is recognised by serum IgE from approximately 45% of peanut allergy patients. Ara h 3 belongs to the glycinin family of legume storage proteins (S11 plant storage proteins) and is extensively proteolytically processed.This peptide represents a tryptic peptide of Ara h 3. The leucine residue at position 6 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (1), giving this peptide a mass increase of 7 compared to the unlabelled peptide.</p>Degré de pureté :Min. 95%Masse moléculaire :890.5 g/molH-LVSWYDNETGYSNK^-OH
<p>Peptide H-LVSWYDNETGYSNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Eosinophil Major Basic Protein Antibody
<p>Eosinophil major basic protein antibody was raised in mouse using human eosinophil major basic protein as the immunogen.</p>H-ESQAYYDGR^-OH
<p>Peptide H-ESQAYYDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSEDPNEDIVER^-OH
<p>Peptide H-SSEDPNEDIVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CAQK^-NH2
<p>Peptide Ac-CAQK^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPFCVAR^-OH
<p>Peptide H-DPPFCVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGRGKGGKGLGKGGAKRHRKVL-NH2
<p>Peptide H-SGRGKGGKGLGKGGAKRHRKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-CDDYYYGFGCNKFCRPR-OH
<p>Peptide LCBiot-CDDYYYGFGCNKFCRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Tyr]-CNP22, Human
<p>C-type natriuretic peptide (CNP) is a novel urinary biomarker which is part of the natriuretic peptide family. CNP is produced in the kidney and the endothelium and has been localised to renal tubules. CNP expression has also been detected in cardiomyocytes, vascular endothelium, and bone.CNP is synthesized as the precursor 103 amino acid (AA) protein, proCNP (AA 1-103), which is then cleaved into NT-proCNP (AA 1-50) and CNP53 (AA 51-103) by the intracellular endoprotease furin. CNP53 is then cleaved to give the biologically active mature form CNP22 (AA 82-103) and inactive form NT-CNP53 (51-81). CNP primarily acts as an autocrine or paracrine factor and has anti-proliferative and anti-fibrotic properties, including suppression of fibroblast proliferation and collagen production, inhibition of vascular smooth muscle cell proliferation and accelerated regeneration of endothelial cells. CNP is a vasodilator and potent venodilator and slightly elevated levels have been detected in heart failure and renal disease states. CNP has renoprotective properties and is activated during renal injury, where it helps preserve glomerular function and suppress pro-fibrotic processes. Hypoxia, cytokines and fibrotic growth factors, are stimuli for CNP production and release.CNP selectively activates the cell surface particulate guanylyl cyclase receptor B (GC-B), catalysing the conversion of GTP to the downstream second messenger, cyclic guanosine monophosphate (cGMP).</p>Masse moléculaire :2,358.2 g/molH-LIGVPESDVENGTK^-OH
<p>Peptide H-LIGVPESDVENGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[G]-JAK1 peptide (1015-1027)
<p>This peptide is phosphorylated by Janus kinase 1 (JAK1) and is an ideal substrate for use in kinase assays. The JAK family of kinases is essential for the signalling of a host of immune modulators in tumour, stromal, and immune cells where they are highly expressed. JAK family proteins mediate the signalling of the interferon (IFN), IL-6, and IL-2 families of cytokines.JAK kinases are associated with cytokine receptors. Cytokine binding to these receptors results in activation of JAK kinases and receptor phosphorylation. Phosphorylated cytokine receptors recruit STAT proteins, which are then phosphorylated by the activated JAK kinases. Phosphorylated STAT proteins form homo- and hetero-dimers that translocate into the nucleus and function as transcription factors.This JAK1 substrate peptide contains an N-terminal glycine-residue.</p>Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,630.8 g/molH-GPSSVEDIK^-OH
<p>Peptide H-GPSSVEDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSVFPLAP^SSK^-OH
<p>Peptide H-GPSVFPLAP^SSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 45 (EPDVYYTSAFVFPTK)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,764 g/molH-VGAHAGEYGAEALER^^-OH
<p>Peptide H-VGAHAGEYGAEALER^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cys-Ala-Thr-Lys-Val-Asn(NGA2)-Phe-Thr-Glu-Ala-Gln-Lys-Ala-Ala-Leu-Asp-Val
<p>Please enquire for more information about Cys-Ala-Thr-Lys-Val-Asn(NGA2)-Phe-Thr-Glu-Ala-Gln-Lys-Ala-Ala-Leu-Asp-Val including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Couleur et forme :PowderGLP (7-36) Heavy
<p>The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life <-2 minutes) due to proteolytic degradation by the serine protease- dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical use.In this peptide the phenylalanine residue at position 6 is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (1), the leucine residue at position 14 is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (1), and the leucine residue at position 26 is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (1). Additionally, the peptide contains an uncharged C-terminal amide.</p>Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :3,319.7 g/molPep63
<p>Soluble amyloid-β (Aβ) oligomers are key to Alzheimer's disease (AD) pathology. Aβ oligomers constitute a significant component of senile plaques, and the presence of plaques is used to define AD. Soluble Aβ is the most neurotoxic species- its presence correlates with AD onset and early progression. There is no current treatment to prevent the formation of neurotoxic Aβ oligomers. A proposed strategy to treat AD is the inhibition of Aβ oligomer interacting with the NMDA receptor. Disruption of NMDA receptor function and signalling molecules affect neuronal plasticity and development.Pep63 was identified via peptide array to block the interaction between Aβ oligomers and EphB2. Mouse AD model stereotactic administration of Pep63 into the dorsal hippocampus blocked the interaction between Aβ and EphB2, as shown by co-immunoprecipitation and Western blotting. Reduced Aβ presence was detected following Pep63 treatment seen by ELIZA. Pep63 effectively reverses impaired memory deficits determined by the Morris water maze (MWM) on the AD mouse model.</p>Masse moléculaire :1,145.7 g/molAzhx-Penetratin
<p>Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. This penetratin has been synthesised with an N-terminal 6-azidohexanoic acid (Azhx) which can be used for various applications as a linker.</p>Couleur et forme :PowderMasse moléculaire :2,384.4 g/molH-ASSIIDEL^FQDR-OH
<p>Peptide H-ASSIIDEL^FQDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anoplin
<p>Antimicrobial and cytolytic peptide isolated from the venom of the spider wasp Anoplius samariensis. Anoplin has potent and board-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria, antifungal properties against some plant pathogenic fungi, and no haemolytic activity against human erythrocytes. At 10 amino acids long, anoplin is the smallest naturally occurring antimicrobial and cytolytic peptide, its small size may have advantages for chemical manipulation and medical application.</p>Masse moléculaire :1,153.5 g/molAc-SACRNLFG-NH2
<p>Peptide Ac-SACRNLFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLPAPIEK^-OH
<p>Peptide H-GLPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 54
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,697.9 g/molLeu-Thr-Ile-Ile-Pro-Gln-Asp-Pro-Ile-Leu-Phe-Ser-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C82H136N20O23Masse moléculaire :1,770.08 g/molRSV Antibody
<p>RSV Antibody is a medicament that contains Monoclonal Antibodies, which are highly specific antibodies produced in a laboratory setting. These antibodies are designed to target and neutralize the Respiratory Syncytial Virus (RSV), a common viral infection that affects the respiratory system. RSV Antibody is used in the field of Life Sciences as an antiviral treatment option.</p>H-GGGGGC-NH2
<p>Peptide H-GGGGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EC dipeptide
<p>EC-acid has a formal charge of 0 and a range of biological and chemical uses. CE-acid is also available in our catalogue.</p>Masse moléculaire :250.1 g/molFGFR substrate
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,681.3 g/molH-VTLVVGASQDIIPQLK^-OH
<p>Peptide H-VTLVVGASQDIIPQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Caffeoylputrescine
CAS :<p>Caffeoylputrescine is an analog of putrescine, a polyamine that is naturally found in urine. It has been shown to have potent anticancer properties by inducing apoptosis in cancer cells. Caffeoylputrescine inhibits the activity of kinases, which are enzymes that play a key role in cell growth and division. This inhibition leads to decreased tumor growth and increased cancer cell death. Additionally, caffeoylputrescine has been shown to enhance the activity of nifedipine, a calcium channel blocker commonly used for hypertension treatment. This compound also acts as a protein kinase inhibitor and may be useful in the development of new anticancer drugs for humans.</p>Formule :C13H18N2O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :250.29 g/molBiotin-Histone H3 (14-34) pT22 K23Me3
<p>H3 is a core component of the nucleosome, functioning in DNA compaction and availability to transcription machinery. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodelling. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. There is a wealth of data recording these modifications but understanding their significance is not as clear. In Caenorhabditis elegans H3K23me3 can be induced by exogenous dsRNA and this modification can persist for four generations after the dsRNA exposure has been stopped. H3K23me3 is enriched in C. elegans heterochromatic regions, the histone methyltransferase SET-32, methylates H3K23 in vitro.A 20-mer fragment of the N terminal histone tail is provided here with threonine 22 phosphorylated and lysine 23 tri-methylated (pT22 K23Me3) with an N terminal biotin label attached. The biotin label should allow for easy use in detection by fluorescence microscopy, ELISA or western blots. Alternatively, it can be purified for protein-protein interactions with the appropriate affinity purification protocol.</p>Couleur et forme :PowderMasse moléculaire :2,456.3 g/molH-ELLQTELSGFLDAQK^-OH
<p>Peptide H-ELLQTELSGFLDAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEALLLGGLPQEGLAR^-OH
<p>Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-RGPGRAFVTIGKIGNMR-NH2
<p>Peptide LCBiot-RGPGRAFVTIGKIGNMR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIFPLAER^-OH
<p>Peptide H-GIFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLVQQEGQLEQQER^-OH
<p>Peptide H-HLVQQEGQLEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
