Produits biochimiques et réactifs

<p>H-EYGSNMTIECKFPVEKQLDL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EYGSNMTIECKFPVEKQLDL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EYGSNMTIECKFPVEKQLDL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EYGSNMTIECKFPVEKQLDL-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-GLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cytokeratin 8 antibody was raised in mouse using a purified recombinant form of human cytokeratin 8 (aa 391-483) expressed in E. coli as the immunogen</p>

<p>GCSF antibody was raised in Mouse using recombinant human G-CSF as the immunogen.</p>

<p>Peptide H-LQDAYGGWANR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GLRLGWEALKYLWNL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLRLGWEALKYLWNL-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLRLGWEALKYLWNL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLRLGWEALKYLWNL-OH at the technical inquiry form on this page</p>

<p>Doxycycline is a tetracycline antibiotic that is used to treat a range of bacterial infections. It is a broad-spectrum antibiotic. This drug inhibits bacterial protein synthesis by binding to its 30S prokaryotic ribosomal subunit. It also inhibits the production of essential proteins required for the bacterial to survive.</p>

<p>Peptide H-SGRGKGGKGLGKGGAKRHRKVLRD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AL^NSEALSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Neuropeptide S (NPS) is a neuropeptide found in mammalian brains, primarily in neurons in the lateral parabrachial nucleus, the peri-locus coeruleus and the principle sensory 5 nucleus of the trigeminus. NPS in involved in several neuroendocrine, behavioural and inflammatory responses, including: reducing anxiety in mice- suppressing appetite and inducing wakefulness and hyperactivity. NPS treatment can be used to improve fear extinction in mice and limit fear memory retrieval after fear reduction training, thus making it an interesting target for treatment of post-traumatic stress disorder. NPS exerts its actions by binding to a G-protein coupled receptor, NPSR.</p>

<p>H-DYVITTQHWLGLLGP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DYVITTQHWLGLLGP-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DYVITTQHWLGLLGP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DYVITTQHWLGLLGP-OH at the technical inquiry form on this page</p>

<p>Peptide Fmoc-AACK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ApoA-I antibody was raised in goat using highly purified human Apo A-I. as the immunogen.</p>

<p>Peptide LCBiot-HFRRHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-RLRKGYAPLMETGLS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RLRKGYAPLMETGLS-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RLRKGYAPLMETGLS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RLRKGYAPLMETGLS-OH at the technical inquiry form on this page</p>

<p>Peptide H-LPGTYVVVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FELLPTPPLSPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Naltrexone is a derivate of noroxymorphone and is a narcotic antagonist used for the treatment of opioid overdose. This drug is a pure opioid antagonist and blocks the effects of endogenous opioids.</p>

<p>H-VSSASTKGPSVFPLAPSSKS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VSSASTKGPSVFPLAPSSKS-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VSSASTKGPSVFPLAPSSKS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VSSASTKGPSVFPLAPSSKS-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>HLA-A*02 is a class I major histocompatibility complex (MHC) allele which is part of the HLA-A group of human major histocompatibility complex (MHC) leukocyte antigens (HLA). HLA-A is a human MHC class I cell surface receptor and is involved in presenting short polypeptides to the immune system. These polypeptides are typically 7-11 amino acids in length and originate from proteins being expressed by the cell. Cytotoxic T cells in the blood "read" the peptide presented by the complex and should only bind to non-self peptides. If binding occurs, a series of events is initiated culminating in cell death via apoptosis. Hepatitis B virus (HBV) polymerase is a multifunctional enzyme that can use both RNA and DNA as a template for amplification and also has an RNase H function. First the polymerase acts on the HBV pre-genomic RNA (pgRNA) to reverse transcribe it to form the (-) DNA strand. Simultaneously the RNA template is degraded by the polymerases RNase H activity, except for a stretch of RNA at 5' end of the pgRNA which is used to prime the synthesis of the (+) DNA strand. This process results in a new partially double-stranded relaxed circular DNA molecule (rcDNA) within a new capsid.</p>

<p>H-TLYRMGFPEAARKGNSS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLYRMGFPEAARKGNSS-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLYRMGFPEAARKGNSS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLYRMGFPEAARKGNSS-OH at the technical inquiry form on this page</p>

<p>Peptide H-GGPFSDSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Aoa-KDEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Opiorphin is a naturally occurring peptide, which is derived from human bodily secretions, particularly from saliva. It acts as an endogenous inhibitor of enkephalin-degrading enzymes, thus enhancing the activity of endogenous opioid peptides by preventing their breakdown. This stabilization of enkephalins contributes to the body's natural pain regulation processes.</p>

<p>H-FVQWFVGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FVQWFVGL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FVQWFVGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FVQWFVGL-OH at the technical inquiry form on this page</p>

<p>Peptide H-IIAPPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Ala-Rink-Amide MBHA Resin is a resin used in peptide synthesis. It is mainly used as an inhibitor of peptidase A or B, and can also be used to inhibit the proteolytic activity of other enzymes. This product has CAS No. 68945-59-6, and is available in a high purity 99% form. Fmoc-Ala-Rink-Amide MBHA Resin is mainly used as a research tool for the study of protein interactions, activator ligands, and receptor ligands. It can also be used for biochemistry experiments involving ion channels and antibodies.</p>

<p>BNP Human, recombinant is a research tool that is an activator of the BNP receptor. It has been used to study the interactions and functions of ion channels, cell biology, and pharmacology. The purified protein is a ligand for the BNP receptor. BNP Human, recombinant has been shown to inhibit peptide bonds in proteins by specific binding to the carboxyl terminus of peptides with a sequence of C-terminal arginine residues.</p>

<p>Peptide H-DQGGELLSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Streptolysin O (SLO) Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Streptolysin O (SLO) Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CASPLHHISN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Adenylate cyclase activator; forskolin analogue</p>

<p>Interleukin-2 Human Recombinant protein.</p>

<p>Ac-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 is a peptide that is a melanocortin receptor agonist. It has been shown to have biochemically active properties and can be used as a research tool in the study of peptides and their receptors.</p>

<p>Epalrestat is a carboxylic acid derivative that is used for the treatment of diabetic neuropathy. This drug is an aldose reductase inhibitor and aims to reduce the accumulation of intracellular sorbitol. Studies in rats have shown this drug to improve morphological abnormalities of nerves.</p>

<p>FGF-2 is a protein that belongs to the FGF family. It is an activator of erythropoietin, which stimulates the production of red blood cells. FGF-2 also acts as a ligand for FGFR1 and FGFR2, which are receptors for FGF-2. The binding of FGF-2 to these receptors leads to a cascade of cellular responses by activating different types of ion channels and proteins involved in cell proliferation and differentiation. This protein is purified from mouse sources with high purity and no detectable endotoxin levels.</p>

<p>EBV antibody was raised in mouse using p120 and p160 capsid antigen of EBV as the immunogen.</p>

<p>H-D-Glu(Gly-OH)-OH is a peptide that is used to study the mechanism of glutamate receptors. It has been shown to have an excitatory effect on mouse hippocampal and cerebellar purkinje neurons, with affinity values for membrane channels. It also has been shown to reduce gamma-aminobutyric acid (GABA) levels in the hippocampus and striatum, which may be due to its ability to inhibit glutamic acid decarboxylase. H-D-Glu(Gly-OH)-OH is a potent antagonist of glutamate, binding competitively at the glutamate site on ionotropic receptors. It also inhibits acidic pH and calcium ion concentrations, which are necessary for ionotropic receptor activation.</p>

<p>H-CGGSAQSQRAPDRVLS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGSAQSQRAPDRVLS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGSAQSQRAPDRVLS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGSAQSQRAPDRVLS-OH at the technical inquiry form on this page</p>

<p>Peptide H-GAPVNISSSDLTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anaplasma Phagocytophilum Surface Protein AipA (Partial-length), Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA (Partial-length), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Pal-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CVQHHRERKRASKSSKHSMS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-FAOOFAOOFOOFAOOFAOFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Osteocalcin antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of osteocalcin. Osteocalcin is a protein involved in bone formation and remodeling. This antibody specifically binds to osteocalcin, preventing its activation and inhibiting its function.</p>

<p>Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS</p>

<p>IL-6 Mouse is a recombinant protein that belongs to the cytokine family. It has been shown to activate IL-6 receptor. This receptor is a member of the GPCR family and possesses seven transmembrane domains with a large extracellular loop between TM2 and TM3. The extracellular domain contains binding sites for two different classes of ligands, including peptides and proteins. IL-6 Mouse is an antibody against IL-6 receptor that can be used as a research tool in pharmacology, protein interactions, cell biology, or immunology.<br>IL-6 Mouse is produced by high purity process and it contains no detectable levels of endotoxin or pyrogens.</p>

<p>Peptide Ac-CENQIYDLPEGAHEHFPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>