Produits biochimiques et réactifs

<p>NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL</p>

<p>Peptide H-VTDALNATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Hexylcaine Hydrochloride (USP grade powder) chemical reference substance</p>

<p>H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).</p>

<p>IL-13 is a cytokine that belongs to the IL-4 family of cytokines. IL-13 is an activator of B cells and mast cells. It binds to the IL-4 receptor and can activate lymphocytes, macrophages, eosinophils, basophils, and neutrophils. This cytokine has been shown to inhibit ion channels in airway epithelium cells and also bind to the alpha1 subunit of the N-methyl d-aspartate receptor. IL-13 is also a ligand for the IL-4 receptor, which may be important for its function as a regulator of other cytokines such as TNFα or IFNγ.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-EGASARAPSPTLELASRSPS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGASARAPSPTLELASRSPS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGASARAPSPTLELASRSPS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGASARAPSPTLELASRSPS-OH at the technical inquiry form on this page</p>

<p>Insulin antibody was raised in mouse using biosynthetic human insulin as the immunogen.</p>

<p>H-SNRILWIGIANFQLCPLIL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SNRILWIGIANFQLCPLIL-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SNRILWIGIANFQLCPLIL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SNRILWIGIANFQLCPLIL-OH at the technical inquiry form on this page</p>

<p>Capecitabine is a chemotherapeutic agent that is used in the treatment of various cancers such as gastrointestinal, breast and pancreatic. This drug is a nucleotide metabolic inhibitor and inhibits DNA synthesis and slows the growth of tumor tissue. It is a prodrug of Fluorouracil.</p>

<p>Pigment Red 171 is a polyester that can be used as an additive to plastics. It has a molecular weight of about 400 and contains a hydroxyl group, which gives it thermal expansion properties. Pigment Red 171 also contains an aluminium skeleton that provides inorganic stability. This pigment has a basic group, which makes it soluble in organic solvents such as sulfides and alcohols. The pigment is resistant to light and radiation, which allows it to be used for protective coatings or sensors. Pigment Red 171 has functional groups for use in organic synthesis reactions.</p>

<p>Rabbit anti-chicken IgY (H + L) (FITC) was raised in rabbit using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Desmin, human, recombinant is a protein that is commonly used in research studies. It is produced using E.coli as the host organism. Desmin plays a crucial role in maintaining the structural integrity of muscle cells. It forms a network of intermediate filaments that provide support and stability to muscle fibers. This recombinant form of desmin is often used in experiments to study its function and interactions with other proteins. Researchers can use this protein to gain insights into various cellular processes and mechanisms related to muscle development, contraction, and disease. Its high purity and quality make it an ideal choice for scientific investigations requiring reliable and consistent results.</p>

<p>The Morphine antibody is a highly specialized monoclonal antibody that plays a crucial role in various aspects of Life Sciences. This antibody specifically targets and neutralizes the effects of morphine, a potent painkiller and opioid drug. By binding to morphine molecules, the antibody prevents their interaction with receptors in the body, thereby inhibiting their cytotoxic and growth factor properties.</p>

<p>Gliadin Antibody is an acidic antibody that targets the vascular endothelial growth factor (VEGF), a key regulator of blood vessel formation. It is commonly used in Life Sciences research to study angiogenesis and the role of VEGF in various biological processes. Gliadin Antibody is a monoclonal antibody that specifically binds to VEGF, inhibiting its interaction with its receptor and preventing downstream signaling pathways involved in blood vessel growth. This antibody has also been used in assays to detect the presence of VEGF in biological samples and to study its interactions with other molecules such as calmodulin and erythropoietin. Additionally, Gliadin Antibody has shown potential therapeutic applications in diseases characterized by abnormal angiogenesis, such as cancer and certain cardiovascular disorders.</p>

<p>EPO antibody was raised in mouse using human EPO as the immunogen.</p>

<p>Streptavidin Poly-HRP80 Conjugate (diluted to 2 µg/mL in stabilizer 85R-104).</p>

<p>Purified recombinant CD46 protein (His tag)</p>

<p>Cathepsin D antibody was raised in rabbit using purified cathepsin D (liver) as the immunogen.</p>

<p>Selective serotonin reuptake inhibitor; anti-depressant</p>

<p>C.I. Disperse Orange 31 is a dye that inhibits the growth of bacteria by binding to the cellulose acetate in the cell wall. Alcohol residue and deionized water have been shown to have an inhibitory effect on the dye's binding capacity. The molecular modelling of this compound has revealed that it is a monomer with two dyestuffs, amines, and a phenolic group. It is resistant to cleavage by brazilin and resistant to uptake by bacteria.<br>DISPERSE ORANGE 31 is an organic dyestuff widely used in industrial dyes, textiles, plastics, paper processing chemicals, etc. It belongs to the group of hydroxyphenylazo compounds and its molecular formula is C16H12N2O4S2Na2O3-HCl. This product can be used as an antibacterial agent for industrial or residential applications because it has strong inhibitory effect on bacterial growth due to its high solubility and</p>

<p>Peptide H-DASGVTFTWTPSSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LLHSDYMNMTPRRPGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLHSDYMNMTPRRPGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLHSDYMNMTPRRPGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLHSDYMNMTPRRPGC-OH at the technical inquiry form on this page</p>

<p>NCOA1 antibody was raised in mouse using recombinant Human Nuclear Receptor Coactivator 1 (Ncoa1)</p>

<p>H-Ala-Asp-OH is a tetrapeptide that belongs to the group of p2, acidic, magnetic and isomeric haemoglobins. This molecule has been shown to hydrolyze enzymes in red blood cells. H-Ala-Asp-OH also binds to red blood cells and may be involved in the regulation of oxygen transport. The magnetic properties of this molecule have been studied by NMR spectroscopy and X-ray crystallography.</p>

<p>Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.</p>

<p>Please enquire for more information about C.I.Direct green 89 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-SFFSFLGEAFDGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Suc-Glu-Ala-Leu-Phe-Gln-pNA is a substrate for human rhinovirus 3C protease. The peptide is a mixture of four amino acids and has been synthesized to serve as an inhibitor of the HRV3C protease enzyme. Suc-Glu-Ala-Leu-Phe-Gln-pNA is expected to inhibit the HRV3C protease by binding to the active site, thereby preventing cleavage of viral proteins that are needed for replication.</p>

<p>Peptide H-TTPPVLDSDGSFFLYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about rec FGF acidic (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The CKMB antibody is a highly specialized product used in the field of Life Sciences. It belongs to the class of Antibodies and specifically targets CKMB dimers. This Monoclonal Antibody is designed to immobilize and neutralize activated CKMB, which is crucial for accurate diagnostic testing.</p>

<p>Peptide Ac-YLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Insulin/proinsulin antibody was raised in mouse using purified mouse Insulin and proinsulin as the immunogen.</p>

<p>Disperse red 88 is a synthetic, cationic surfactant that is used in the textile industry. It has a colorless liquid with a low viscosity and low toxicity. Disperse red 88 is soluble in organic solvents and water. Disperse red 88 can be activated by light or radiation. The color of disperse red 88 depends on the medium it is in: when dispersed in an organic solvent, it exhibits an orange-red color; when dispersed in water, it exhibits a yellow-orange color. Disperse red 88 can be used as a pigment for textile dyeing and printing, as well as for paint production. Disperse red 88 will react with atmospheric moisture to form perchloroethylene (PCE), which is toxic to humans and animals.</p>

<p>Prolactin antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to prolactin, a hormone involved in various physiological processes. This antibody can be used in experiments to study the role of prolactin in different cell types, such as granulosa cells. The antibody forms a complex with prolactin, allowing researchers to detect and measure the levels of prolactin in samples using techniques like ELISA or Western blotting. Additionally, this monoclonal antibody has neutralizing properties, meaning it can inhibit the biological activity of prolactin. The Prolactin antibody is an essential tool for scientists investigating the functions and mechanisms of this important hormone.</p>

<p>H-SFQLFGSPPGQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SFQLFGSPPGQR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SFQLFGSPPGQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SFQLFGSPPGQR-OH at the technical inquiry form on this page</p>

<p>H-EPPPWENEATER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EPPPWENEATER-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EPPPWENEATER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EPPPWENEATER-OH at the technical inquiry form on this page</p>

<p>H-SIAGVAAQEIR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SIAGVAAQEIR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SIAGVAAQEIR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SIAGVAAQEIR-OH at the technical inquiry form on this page</p>

<p>Doxazosin is a first-generation α1-adrenergic receptor antagonist that is used in the treatment of hypertension and urinary obstruction, It has been shown to be effective in combination therapy for patients with benign prostatic hyperplasia.</p>

<p>Cellulose synthase is a crucial enzyme involved in the synthesis of cellulose. Cellulose is an aggregation of unbranched polymer chains made of β-(1-4)-linked glucose residues, and is a component of primary and secondary cell walls - functioning to primarily maintain strength and shape in cells. Cellulose is synthesised by large cellulose synthase complexes (CSCs), which consist of synthase protein isoforms (CesA) that are arranged into a unique hexagonal structure. Cellulose synthase Light [Populus tomentosa] is specific to the Populus tomentosa species.</p>

<p>Neuropeptide and hormone involved in many processes, including- social bonding--sexual reproduction- childbirth and breastfeeding. Oxytocin is synthesised in the hypothalamus as a prepropeptide consisting of a signal peptide, the oxytocin peptide hormone, a processing signal and the carrier protein- neurophysin. The prohormone then undergoes endoproteolytic cleavage and amidation to form the final oxytocin peptide.Dysregulation of oxytocin has been implicated in the pathophysiology of neuropsychiatric disorders that impact social functioning, such as autism, schizophrenia, and depression as well as anorexia nervosa. Intranasal oxytocin administration may reduce amygdala activity and amygdala-midbrain connectivity in response to fearful situations- reduce cortisol release and anxiety in response to psychosocial stress- increase trust behaviour- increase the ability to interpret mental states, and increase the amount of time spent gazing at the eyes when viewing faces.</p>

<p>Serotonin uptake inhibitor; anti-depressant</p>

<p>RAG8 is a pepducin- a cell-penetrating palmitoylated peptide with a C-terminal NH2.- Palmitoyl is a 16-carbon aliphatic chain which enhances the hydrophobicity of the peptide, and therefore improves its penetration through lipid structures.The peptide sequence corresponds to a key regulatory sequence at the intracellular C-terminus of PAR4. This motif regulates calcium signalling and PAR4 interactions with the signalling protein-β-arrestin. RAG8 is a PAR4 antagonist that can attenuate calcium signalling and β-arrestin-1 and 2 recruitment to PAR4 which has been activated with the PAR4 agonist AYPGKF-NH2.Disrupting this PAR4/β-arrestin signalling pathway with RAG8 blocks PAR4 dependent platelet activation and reduces stability of blood clots.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside</p>

<p>Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are fundamental in compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4's lysine rich tail plays a role in the higher order chromatin folding.Modifications allow histones to contribute to gene regulation, chromosome condensation and DNA repair. In yeast, methylation of R3 of Histone 4 results in the recruitment of histone acetyl transferase to the chromatin and the acetylation of Histone 4 K5.</p>

<p>Granzyme B antibody was raised in mouse using recombinant granzyme B as the immunogen.</p>

<p>VP4 is a viral coat protein of Nora virus encoded for by ORF4. The product of these gene is likely cleaved into three capsid proteins, VP4A, B and C. VP4 is also the most conserved gene from Nora virus and related viruses. Nora virus is a non-pathogenic virus found in gut of Drosophila melanogaster. It causes persistent, non-pathological infection, it replicates in the fly gut and is transmitted via the faecal-oral route. Nora virus has a 12333 nucleotides long single-stranded RNA genome of positive polarity.</p>

<p>Post-transmembrane region (PTM) from the envelope protein (E) of the coronavirus- Mouse Hepatitis Virus (MHV). This protein region is involved in direct membrane binding, with the C-terminal hydrophobic residues of this peptide, thought to be most relevant for membrane binding. After replication, coronaviruses (CoVs) assemble on intracellular membranes, the coronavirus envelope protein (E) is involved in virus assembly and release. E proteins have been located in the endoplasmic reticulum Golgi intermediate compartment (ERGIC) and Golgi of infected cells but are not thought to traffic to the cell surface of infected cells. CoV E is a small hydrophobic protein which is conserved between coronaviruses. E consist of a short hydrophilic amino terminal region, a hydrophobic transmembrane region and a carboxy-terminal region. CoV E protein is an integral membrane protein.E has been considered a therapeutic target for SARS-CoV-2.</p>

<p>[Atto655]-LifeAct (Abp140 1-17) contains the 17 amino acid peptide Lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing Lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. One application of lifeact is in the study of plant development and pathogen defence as filamentous actin within the plant's actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements. The addition of the oxazine fluorophore Atto655 which has single molecule (SM) imaging properties allows the location of the LifeAct (Abp140 1-17) to be detected.</p>