Produits biochimiques et réactifs

<p>H-GACGVG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GACGVG-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GACGVG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GACGVG-OH at the technical inquiry form on this page</p>

<p>CD28 antibody (Allophycocyanin) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>Anti-Human IL-17A Monoclonal Antibody</p>

<p>Anti-Human CD3xBCMA Bispecific Antibody</p>

<p>PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Anti-Human NT5E Monoclonal Antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Anti-Human CD73 Monoclonal Antibody</p>

<p>Peptide H-FITLVPSNLPHEATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HCG protein is a recombinant protein that plays a crucial role in various immunological processes. It acts as an antigen, initiating an antigen-antibody reaction, and is involved in the production of immunoglobulin molecules. HCG protein is widely used in the field of life sciences for research purposes, particularly in studies related to leukocyte antigens and circumsporozoite proteins. It also exhibits growth factor properties and has been shown to stimulate cell proliferation and differentiation. Additionally, HCG protein has antiviral activity and can induce interferon production. Its cytotoxic effects make it a potential candidate for targeted cancer therapies. With its diverse range of applications, HCG protein is an essential tool for scientists and researchers in the field of molecular biology and immunology.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LFDQAFGVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Anti-EGFR human recombinant monoclonal antibody.</p>

<p>Recombinant human IgG1 monoclonal antibody targeting the epithelial cell adhestion molecule (EpCAM)</p>

<p>Anti-FGFR2 monoclonal antibody</p>

<p>Peptide Ac-GSARAEVHLRKS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>C1 Esterase Inhibitor antibody (HRP) was raised in goat using C1 esterase inhibitor purified from human plasma as the immunogen.</p>

<p>Peptide Ac-PRCGVPDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-QEAFSHIRIPLPH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>FABP antibody was raised in mouse using human heart FABP as the immunogen.</p>

<p>Anti-Human CCL2 Monoclonal Antibody</p>

<p>The HRP2 antibody is a diagnostic reagent used in Life Sciences for the detection of a specific target molecule. It is a monoclonal antibody that specifically binds to HRP2, allowing for accurate and sensitive detection. The HRP2 antibody can be used in various applications, such as ELISA or Western blotting, to detect the presence of HRP2 in samples.</p>

<p>Peptide H-NEALIALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Mouse monoclonal antibody targeting tumor-associated glycoprotein (TAG-72)</p>

<p>A humanized anti-CD147 monoclonal antibody.</p>

<p>Anti-TNF alpha mouse monoclonal antibody; TNF inhibitor</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Warfarin antibody was raised in rabbit using warfarin-KLH as the immunogen.</p>

<p>LOXO-305 is a small molecule inhibitor, which is a synthesized chemical compound designed to selectively target specific enzymes or pathways. Its source is rooted in medicinal chemistry and pharmacological research aimed at elucidating pathways involved in oncogenesis.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. It has been extensively studied using a patch-clamp technique on human erythrocytes, showing its high frequency of human activity. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Peptide H-YIPIQYVLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-RNRRKELTDFLQAET-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RNRRKELTDFLQAET-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RNRRKELTDFLQAET-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RNRRKELTDFLQAET-OH at the technical inquiry form on this page</p>

<p>The M13 phage antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to steroids, making it an essential component in various research applications. By utilizing an activated electrode, scientists can easily detect and measure the concentration of cortisol, a stress hormone, in biological samples. The M13 phage antibody also plays a crucial role in recombination studies, allowing researchers to manipulate DNA sequences and create novel genetic constructs. Additionally, this antibody has been used to study the glycoprotein composition of various test substances, providing valuable insights into their structure and function. With its high specificity and affinity, the M13 phage antibody is widely used in the production of Monoclonal Antibodies for diagnostic and therapeutic purposes. It has also been employed in liver microsome studies to investigate drug metabolism and evaluate potential drug-drug interactions. Furthermore, this versatile antibody has shown promise in regulating interleukin-6 levels, a key cytokine involved in immune response modulation</p>

<p>Human IgG Fc antibody was raised in goat using purified hIgG Fc as the immunogen.</p>

<p>H-CGGSAQSQRAPDRVLS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGSAQSQRAPDRVLS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGSAQSQRAPDRVLS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGSAQSQRAPDRVLS-OH at the technical inquiry form on this page</p>

<p>Humanized monoclonal antibody targeting E. coli Shiga-like toxin II B subunit</p>

<p>Please enquire for more information about Homoglutathione H-Glu(Cys-b-Ala-OH)-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Legionella pneumophila antibody</p>

<p>Humanized monoclonal antibody targeting CD200; for use in oncology</p>

<p>Goat anti Mouse IgG2a secondary antibody (Alk Phos)</p>

<p>Anti-CD4 humanized antibody; immunomodulator</p>

<p>Anti-CD40 human monoclonal antibody; used to prevent organ transplant rejection</p>

<p>H-GVSAYLSRPSPFDGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GVSAYLSRPSPFDGGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GVSAYLSRPSPFDGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GVSAYLSRPSPFDGGC-OH at the technical inquiry form on this page</p>

<p>Peptide H-DLYANTVL^SGGTTMYPGIADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-K^TSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-WRCTRVGTE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WRCTRVGTE-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WRCTRVGTE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WRCTRVGTE-OH at the technical inquiry form on this page</p>

<p>Peptide H-TSYQV^YSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>