Produits biochimiques et réactifs

<p>Feline Parvovirus Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Parvovirus Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Atorvastatin-d5 sodium is an isotopically labeled pharmaceutical compound, which is derived from atorvastatin by incorporating deuterium atoms. This synthetic modification is essential for tracing and quantification in pharmacokinetic studies. As a statin, its mode of action involves the selective inhibition of the enzyme HMG-CoA reductase, a crucial catalyst in the mevalonate pathway responsible for cholesterol biosynthesis in the liver. By inhibiting this enzyme, atorvastatin-d5 effectively lowers the production of low-density lipoprotein (LDL) cholesterol.</p>

<p>West Nile Virus Antigen, Uganda Strain B956 is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about West Nile Virus Antigen, Uganda Strain B956 including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Diacetylated Monoglycerides (USP grade powder) chemical reference substance</p>

<p>Rabbit polyclonal Gamma enolase antibody (HRP)</p>

<p>AMH Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about AMH Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-RTASPPAIPVHLHPHQTMIP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RTASPPAIPVHLHPHQTMIP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RTASPPAIPVHLHPHQTMIP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RTASPPAIPVHLHPHQTMIP-OH at the technical inquiry form on this page</p>

<p>[Ni(dtbbpy)(H2O)4]Cl2 is a coordination complex, which is a specialized form of chemical compound where a central metal atom, in this case, nickel (Ni), is surrounded by ligands, such as 4,4'-di-tert-butyl-2,2'-bipyridine (dtbbpy) and water molecules. This complex is synthesized through a precise coordination process, where ligands are added to the metal center facilitating its unique structural properties.</p>

<p>YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV</p>

<p>Peptide H-SGTDVDAANL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>RFamide peptides are a family of neuropeptides that are involved in the regulation of appetite and metabolism. Pyroglutamylated RFamide peptide (human) is an inhibitor of the G protein-coupled receptor, which has been shown to activate the Ligand-gated ion channel. The high purity of this product makes it suitable for use in research as well as antibody production.</p>

<p>ApoA-II antibody was raised in goat using purified human apolipoprotein A-l as the immunogen.</p>

<p>Fmoc-Met-Rink-Amide MBHA Resin is a peptide that can be used as an activator for antibodies, research tool for ion channels and life science. It has high purity and is a CAS No. The resin is an inhibitor for protein interactions and can be used to study pharmacology.</p>

<p>Interleukin-1 (IL-1) is a protein that is involved in the regulation of many aspects of the immune system. IL-1 is produced by macrophages and other cells, and it stimulates the production of other cytokines and has anti-inflammatory effects. IL-1 can also stimulate the release of certain enzymes such as elastase from neutrophils, which may have a role in chronic inflammatory diseases. Interleukin 1 has been shown to be an MALT1 substrate, a protein that regulates Mucosa Associated Lymphoid Tissue lymphoma translocation protein (MALT). The MALT1 enzyme is involved in regulating inflammation and immunity, as well as tumor progression.</p>

<p>Ac-Ala-Ala-OH is a compound that has been shown to bind to the receptor molecule, and is stable in the presence of proton. It also forms stable complexes with amide and teicoplanin. Ac-Ala-Ala-OH has a carbonyl group, which can be detected by magnetic resonance spectroscopy (MRS) at 1.8 ppm. The compound also has an nmr spectrum in which it can be seen that the trifluoroacetic acid does not affect the binding experiments. Ac-Ala-Ala-OH is used for binding experiments because it binds specifically to the receptor molecule and has a number of other properties that make it useful for research purposes.</p>

<p>Gly-Pro-Pro (Gly-Pro-Pro)7 is a peptide that has been shown to inhibit the activity of various proteases, including collagenase and elastase. It also inhibits the activity of matrix metalloproteinases, which are enzymes that degrade collagen and other extracellular matrix proteins. Gly-Pro-Pro (Gly-Pro-Pro)7 is therefore potentially useful for the treatment of diseases involving excessive degradation of connective tissue.</p>

<p>Amino acids 1-18 of the 28 amino acid peptide hormone Ghrelin which has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Ghrelin is able to associate with the GHS-R due to it containing a unique N-octanoyl group which is linked to its serine 3 residue covalently. Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases.</p>

<p>SDF1 alpha antibody (biotin) was raised in goat using highly pure recombinant murine SDF-1alpha as the immunogen.</p>

<p>H-Gly-Arg-AMC hydrochloride salt is a substrate for the enzymes cathepsins B, H, and L. This compound has been used to measure protease activity in cell culture and as a diagnostic substrate for peptidases. The enzyme reaction can be monitored by measuring changes in the fluorescence of the product at 340 nm. The pH optimum for this enzyme is 7.4.</p>

<p>Fmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB is a pharmacological research tool that is used to study protein interactions. It is also used as an inhibitor in the synthesis of peptides and has a high purity. This resin can be used for the production of antibodies, which are antibodies that specifically bind to a particular antigen. Fmoc-Thr(tBu)-Wang Resin (100-200 mesh) 1% DVB is an ion channel inhibitor that blocks voltage gated sodium channels, which are involved in pain transmission.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Histone Antibody/Nucleosome Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Histone Antibody/Nucleosome Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Procalcitonin (PCT), Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Procalcitonin (PCT), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rabbit polyclonal IGF1R antibody for detection of the Phospho-Tyr1161 form of the IGF1R peptide.</p>

<p>Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Immunodeficiency Virus (FIV) p24 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Vitamin D2/D3 25OH Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Vitamin D2/D3 25OH Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The peptide H-Leu-Ser-Ile-Gly-Lys-Val-NH2 is a PAR3 agonist that has been shown to induce hypertension in animal models. It has also been shown to activate PAR3, which is involved in coagulation and cardiovascular diseases. The peptide is able to activate PAR3 by binding to the receptor with high affinity and selectivity. This activation induces a series of intracellular signaling events that culminate in vasoconstriction and blood clotting.<br>PAR3 agonists are being developed as a new class of antihypertensive drugs because they have shown efficacy in reducing blood pressure levels without causing adverse side effects such as dizziness or fatigue.</p>

<p>Nipah Virus Glycoprotein F Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Nipah Virus Glycoprotein F Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-LSVNTPNNR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LSVNTPNNR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LSVNTPNNR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LSVNTPNNR-OH at the technical inquiry form on this page</p>

<p>Bordetella Pertussis Toxin IgA /IgG Negative Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Bordetella Pertussis Toxin IgA /IgG Negative Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-NGQPENNYKTTPPVLDSD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NGQPENNYKTTPPVLDSD-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NGQPENNYKTTPPVLDSD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NGQPENNYKTTPPVLDSD-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about C.I.Reactive Orange 20 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hydroxy-itraconazole chemical reference substance</p>

<p>Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Glutamate is a nonessential amino acid that is an important neurotransmitter in the central nervous system. It is found in many foods and can be synthesized by the body from other amino acids. Glutamate is also an excitatory neurotransmitter that binds to glutamate receptors, causing depolarization of the postsynaptic cell. This leads to increased intracellular calcium levels and eventually to neuronal death. Glutamate can be taken up by cells through both facilitated diffusion and active transport and converted into glutamine by glutaminase. The uptake of glutamate into cells may have clinical relevance in diseases such as hepatic steatosis, schizophrenia, or Alzheimer's disease.<br>Glu(Gln-OH)-OH (HGG) is a synthetic compound that has been shown to inhibit enzymes involved in the shikimate pathway, which converts chorismate into aromatic amino acids such as phenylalanine, tyrosine, and tryptophan. HGG has been</p>

<p>H-Arg-Ala-Asp-Ser-Lys-OH is a peptide that is used in biochemistry research as a substrate for protease enzymes. It has the sequence H-Arg-Ala-Asp-Ser-Lys and is labeled with a fluorescent dye.</p>

<p>Ac-FLAAIG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-FLAAIG-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-FLAAIG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-FLAAIG-OH at the technical inquiry form on this page</p>

<p>Human chorionic gonadotropin (hCG) is a peptide hormone produced in pregnancy, that is made by the embryo soon after conception and later by the part of the placenta. Its role is to prevent the disintegration of the corpus luteum of the ovary and thereby maintain progesterone production that is critical for a pregnancy in humans. hCG may have additional functions, for instance it is thought that it affects the immune tolerance of the pregnancy. Early pregnancy testing generally is based on the detection or measurement of hCG.</p>

<p>Ac-Lys-N-Me-Leu-Val-N-Me-Phe-Phe-NH2 is a peptide that has been shown to inhibit the formation of amyloid fibrils in Alzheimer's Disease. Ac-Lys-N-Me-Leu-Val-N-Me-Phe (KLVFF) is a biologically active peptide that is membrane permeable, allowing it to cross the blood brain barrier and enter the central nervous system. It inhibits the fibrillogenesis of amyloid beta protein, preventing it from aggregating into plaques.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>TentaGel® R RAM Resin (90 um), Rink-type can be used for the preparation of peptide amides (Rink-type) (90 µm) 018-022 meq/g and is specially designed for difficult and long sequences.<br>TentaGel, is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix.</p>

<p>Please enquire for more information about CEA, Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HSV-2 Glycoprotein G, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HSV-2 Glycoprotein G, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about Cy3 SE(mono SO3) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>E. coli O157 antibody was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.</p>

<p>Please enquire for more information about Anti-NR2B antibody - 0.5mg/ml including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Alpha-1-Acid Glycoprotein, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Alpha-1-Acid Glycoprotein, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The Anti-PGII antibody is a highly specialized antibody used in Life Sciences research. It is a monoclonal antibody that specifically targets the antigen binding domain of PGII, which is found in various carcinoma cell lines, including MCF-7. This antibody has shown high specificity and sensitivity in detecting PGII in blood plasma and human serum samples.</p>

<p>1-149 amino acids: MGSSHHHHHH SSGLVPRGSH MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEAD</p>

<p>H-STHGLVINIIHSLCTCSQLH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-STHGLVINIIHSLCTCSQLH-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-STHGLVINIIHSLCTCSQLH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-STHGLVINIIHSLCTCSQLH-OH at the technical inquiry form on this page</p>