Produits biochimiques et réactifs

<p>Bacillus anthracis (anthrax) antibody was raised in mouse using protective antigen of Bacillus anthracis as the immunogen.</p>

<p>IFN Gamma antibody was raised in rabbit using highly pure recombinant human IFN-gamma as the immunogen.</p>

<p>Goat anti-Mouse IgG (HRP) was raised in goat using purified Mouse IgG as the immunogen.</p>

<p>GFAP antibody was raised in rabbit using GFAP isolated from cow spinal cord as the immunogen.</p>

<p>Bordetella pertussis antibody is a monoclonal antibody that specifically targets the tnf-α protein, which plays a crucial role in inflammatory responses. This antibody is widely used in Life Sciences research and diagnostic assays to detect and quantify the presence of tnf-α in various samples. It has been shown to have high specificity and sensitivity, making it an ideal tool for studying the mechanisms of inflammation and developing therapeutic interventions. The antibody is produced using advanced biotechnological techniques, ensuring consistent quality and purity. It is formulated with excipients to enhance stability and glycosylation to improve its binding affinity. Additionally, this monoclonal antibody exhibits neutralizing activity against tnf-α, making it a valuable tool for functional studies. Its high affinity for transferrin receptors enables efficient internalization into cells for downstream applications such as immunofluorescence or flow cytometry analysis. With its exceptional performance and reliability, this Bordetella pertussis antibody is a valuable asset for researchers</p>

<p>Fibroblast Growth Factor protein containing 155 amino acids.</p>

<p>Goat anti-human IgG/IgA/IgM (H+L) (biotin) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>The beta hCG antibody is a monoclonal antibody that has neutralizing properties against the epidermal growth factor. It also interacts with other proteins such as fibrinogen, phosphatase, and lipoprotein lipase. The beta hCG antibody can block the activation of TGF-beta, a key regulator of cell growth and differentiation. Additionally, this antibody can inhibit the activity of chemokines and growth factors involved in various cellular processes. The beta hCG antibody is widely used in Life Sciences research for its ability to target specific molecules and pathways. It is produced using advanced techniques and has high affinity due to its unique histidine composition. Experience the power of this highly specific monoclonal antibody for your research needs.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>The PR1 antibody is a glycoprotein that is primarily found in the intraocular region. It is known to be reactive and can bind to various antigens, including chemokine-like molecules and polymorphic proteins. This antibody has been extensively studied in the field of Life Sciences, particularly in relation to its role in immune responses. The PR1 antibody is capable of inducing an antigen-antibody reaction, which can lead to the production of both polyclonal and monoclonal antibodies. Additionally, it has been found to have neutralizing properties against certain autoantibodies. This makes it a valuable tool for researchers studying immune system function and its potential therapeutic applications.</p>

<p>The Helicobacter pylori antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the helicobacter bacteria, allowing for the detection and study of this pathogen. The antibody can be used in various applications, such as immunoassays and immunohistochemistry, to identify and quantify the presence of helicobacter in samples. Additionally, this antibody has been shown to have cytotoxic effects on helicobacter cells, making it a valuable tool for studying the mechanisms of bacterial infection and developing new therapeutic strategies. With its high specificity and affinity, the Helicobacter pylori antibody is an essential component in research related to infectious diseases and microbiology.</p>

<p>Purified recombinant tTG protein (His tag)</p>

<p>tTG/DGP IgA/IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about tTG/DGP IgA/IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Human IgM protein (Fab mu) (HRP) conjugate</p>

<p>4,4'-Dimethoxytrityl chloride is a versatile compound used in oligonucleotide synthesis as a protecting group. It selectively reacts with thiol groups, allowing for the selective deprotection of nucleosides. This compound can also be used as a calcium scavenger and has been shown to inhibit the formation of d-glucaric acid, which is involved in the metabolism of triptolide. Additionally, 4,4'-Dimethoxytrityl chloride can react with primary alcohols to form esters, making it useful in organic synthesis. It has also been used as an opioid antagonist and has been shown to enhance the stability of sodium perborate in cosmetic formulations.</p>

<p>The ApoB antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. This antibody specifically targets and neutralizes interferon, TGF-beta, phosphatase, tyrosine, glutamate, and dopamine. It is widely used in the field of life sciences for research purposes.</p>

<p>The Canine Distemper Virus antibody is a monoclonal antibody that is cytotoxic to the Canine Distemper Virus (CDV). It specifically targets and binds to the CDV, neutralizing its activity and preventing further infection. This antibody has been extensively tested in various life science studies and has shown high specificity and affinity for the CDV. It can be used in diagnostic assays to detect the presence of CDV in samples, as well as in research studies to investigate the role of CDV in disease development. The Canine Distemper Virus antibody is activated upon binding to the virus, triggering a cascade of immune responses including the production of interferon-gamma (IFN-gamma) and activation of actin filaments. Its high viscosity allows for easy handling and storage. This antibody is an essential tool for researchers studying canine diseases and developing diagnostic tools for CDV detection.</p>

<p>Complement C3 antibody is a polyclonal antibody that specifically targets the complement component C3. This antibody is widely used in life sciences research to study the role of complement activation and its involvement in various physiological processes. Complement C3 plays a crucial role in the immune response, inflammation, and tissue homeostasis. The antibody has been shown to neutralize the activity of C3, inhibiting its function and preventing downstream effects such as the generation of pro-inflammatory cytokines like interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, this antibody can be utilized for genotoxic studies, as it has been shown to bind to plasmids and prevent their uptake into cells. The complement C3 antibody is a valuable tool for researchers studying complement biology, immune responses, and inflammatory processes.</p>

<p>Inhibitor of TOP1 topoisomerase; anti-cancer</p>

<p>25-183 amino acids: MVHHHHHHDP SKDSKAQVSA AEAGITGTWY NQLGSTFIVT AGADGALTGT YESAVGNAES RYVLTGRYDS APATDGSGTA LGWTVAWKNN YRNAHSATTW SGQYVGGAEA RINTQWLLTS GTTEANAWKS TLVGHDTFTK VKPSAASIDA AKKAGVNNGN PLDAVQQ</p>

<p>Conjugated Propoxyphene-BSA hapten</p>

<p>The CKMB Antibody is a highly specific monoclonal antibody that targets the CK-MB isoform of creatine kinase. This antibody is widely used in Life Sciences research to study various aspects of cardiac health and disease. It has been shown to effectively detect and quantify CK-MB levels in human serum, providing valuable insights into cardiac muscle damage and myocardial infarction. Additionally, this antibody has proven utility in immunohistochemistry studies, where it can be used to visualize CK-MB expression in tissue samples, such as amyloid plaques or liver microsomes. With its high specificity and sensitivity, the CKMB Antibody is an indispensable tool for researchers investigating the role of CK-MB in cardiovascular physiology and pathology.</p>

<p>Helicobacter pylori protein is a multifunctional protein that plays a crucial role in various biological processes. It is involved in collagen synthesis, regulation of transforming growth factor-beta 1 (TGF-β1), chemokine production, nuclear signaling pathways, and the release of neurotrophic factors and natriuretic peptides. This protein has been extensively studied in the field of Life Sciences and is widely used as a research tool for studying its neutralizing and inhibitory properties. Additionally, it has been found to interact with insulin and activate protein kinases, making it an important target for therapeutic interventions.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Conjugated Estradiol 6-CMO-BSA hapten</p>

<p>Heme Oxygenase 1 antibody was raised in mouse using a synthetic peptide corresponding to the sequence near the N-terminus of human HO-1 as the immunogen.</p>

<p>Peptide H-WMDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Lipase protein is a collagen-based protein that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences as a native protein and antigen for research purposes. Lipase protein is involved in the breakdown and metabolism of lipids, particularly triglycerides. It acts as an enzyme to catalyze the hydrolysis of lipoprotein lipase, which helps in the absorption and utilization of dietary fats by adipose tissues. Additionally, lipase protein has been found to have natriuretic properties, meaning it promotes the excretion of sodium through urine. This protein also exhibits cytotoxic effects on certain types of cells and has been explored as a potential target for multidrug resistance reversal in cancer therapy. With its neutralizing capabilities, lipase protein can be utilized to counteract the activity of specific toxins or pathogens. Researchers often rely on monoclonal antibodies against lipase protein to study its structure and function in detail. Overall, lipase protein is an

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. Through advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique, its high efficacy in human erythrocytes has been demonstrated. This drug undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>H-FALNGEEFMNFDLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FALNGEEFMNFDLK-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FALNGEEFMNFDLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FALNGEEFMNFDLK-OH at the technical inquiry form on this page</p>

<p>The CXCL1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and inhibit the activity of CXCL1, a protein involved in various biological processes such as inflammation and immune response. This antibody recognizes specific epitopes on CXCL1, allowing for precise targeting and blocking of its function.</p>

<p>The Procalcitonin antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the circumsporozoite protein, which plays a crucial role in the life cycle of certain parasites. By binding to this protein, the Procalcitonin antibody can effectively inhibit parasite growth and replication.</p>

<p>Goat anti Mouse IgG was raised in goat using affinity pure mouse IgG (H + L) as the immunogen.</p>

<p>Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS</p>

<p>The Osteocalcin antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of osteocalcin. Osteocalcin is a protein involved in bone formation and remodeling. This antibody specifically binds to osteocalcin, preventing its activation and inhibiting its function.</p>

<p>Interleukin-2 Human Recombinant protein.</p>

<p>ApoA-I antibody was raised in goat using highly purified human Apo A-I. as the immunogen.</p>

<p>GCSF antibody was raised in Mouse using recombinant human G-CSF as the immunogen.</p>

<p>CMV IgM/IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CMV IgM/IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-AQLGDLPWQVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VEIIATMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Alpha tubulin antibody was raised in mouse using native chick brain microtubules as the immunogen.</p>

<p>Cystatin C Goat Polyclonal Antibody, Affinity Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cystatin C Goat Polyclonal Antibody, Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>CCNB2 antibody was raised in mouse using recombinant Human Cyclin B2 (Ccnb2)</p>

<p>SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL</p>

<p>Calmodulin antibody was raised in sheep using highly purified bovine testes calmodulin as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>1-641 amino acids: MGSSHHHHHH SSGLVPRGSH MAKAAAIGID LGTTYSCVGV FQHGKVEIIA NDQGNRTTPS YVAFTDTERL IGDAAKNQVA LNPQNTVFDA KRLIGRKFGD PVVQSDMKHW PFQVINDGDK PKVQVSYKGD TKAFYPEEIS SMVLTKMKEI AEAYLGYPVT NAVITVPAYF NDSQRQATKD AGVIAGLNVL RIINEPTAAA IAYGLDRTGK GERNVLIFDL GGGTFDVSIL TIDDGIFEVK ATAGDTHLGG EDFDNRLVNH FVEEFKRKHK KDISQNKRAV RRLRTACERA KRTLSSSTQA SLEIDSLFEG IDFYTSITRA RFEELCSDLF RSTLEPVEKA LRDAKLDKAQ IHDLVLVGGS TRIPKVQKLL QDFFNGRDLN KSINPDEAVA YGAAVQAAIL MGDKSENVQD LLLLDVAPLS LGLETAGGVM TALIKRNSTI PTKQTQIFTT YSDNQPGVLI QVYEGERAMT KDNNLLGRFE LSGIPPAPRG VPQIEVTFDI DANGILNVTA TDKSTGKANK ITITNDKGRL SKEEIERMVQ EAEKYKAEDE VQRERVSAKN ALESYAFNMK SAVEDEGLKG KISEADKKKV LDKCQEVISW LDANTLAEKD EFEHKRKELE QVCNPIISGL YQGAGGPGPG GFGAQGPKGG SGSGPTIEEV D</p>

<p>The MUC1 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the MUC1 protein, which is involved in various cellular processes such as cell growth and differentiation. The MUC1 antibody can be used for immunohistochemistry, western blotting, and other techniques to study the expression and localization of MUC1 in different tissues and cell types.</p>

<p>Human IgA antibody was raised in sheep using human secretory piece purified from human colostrum as the immunogen.</p>