Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-EFTVSLHLAR-OH
<p>H-EFTVSLHLAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EFTVSLHLAR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EFTVSLHLAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EFTVSLHLAR-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%β-Ala-Lys(AMCA)
CAS :<p>β-Ala-Lys(AMCA) is a peptide that can inhibit the interactions of proteins. β-Ala-Lys(AMCA) is an inhibitor of protein interactions and can be used as a research tool to study the interactions between proteins. β-Ala-Lys(AMCA) has been shown to activate certain receptors, such as the receptor for angiotensin II, and can be used to increase or decrease the activity of ligands. This drug also has a high purity level, which makes it suitable for use in life science research.</p>Formule :C21H28N4O6Degré de pureté :Min. 95%Masse moléculaire :432.47 g/molAc-CAQAGLKPEQA-NH2
<p>Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTDALNATR^-OH
<p>Peptide H-VTDALNATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGLELPEDEEEK^-OH
<p>Peptide H-EGLELPEDEEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tropisetron hydrochloride
CAS :<p>5-HT3 receptor antagonist; alpha-7 nicotinic acetylcholine receptor partial agonist</p>Formule :C17H20N2O2•HClDegré de pureté :Min. 95%Masse moléculaire :320.81 g/molH-DPGVLDR^-OH
<p>Peptide H-DPGVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Camstatin
CAS :<p>Camstatin is an adjuvant therapy that has been shown to inhibit the activation of protein kinase A (PKA) in cells. It also inhibits phosphorylation of the cAMP-dependent protein kinase, which leads to a potentiation of effects. Camstatin also has a potent inhibitory effect on cellular protein synthesis and phosphate uptake. Camstatin can be used as an inhibitor of the phosphodiesterase enzyme, which is involved in the hydrolysis of intracellular cyclic nucleotides. This prevents the breakdown of cAMP and therefore increases its concentration in the cell and activates PKA.</p>Formule :C122H203N39O34Degré de pureté :Min. 95%Masse moléculaire :2,760.2 g/molH-ELNRKMIYM-OH
<p>H-ELNRKMIYM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ELNRKMIYM-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ELNRKMIYM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ELNRKMIYM-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-TLTLFNVTR^-OH
<p>Peptide H-TLTLFNVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFTPVL^QADFQK-OH
<p>Peptide H-EFTPVL^QADFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLTKILTI^-OH
<p>Peptide H-FLLTKILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGVNGF^G^R-OH
<p>Peptide H-VGVNGF^G^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ala-Val-Ile
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C14H27N3O4Masse moléculaire :301.38 g/molCarvedilol - Bio-X ™
CAS :Produit contrôlé<p>Carvediol is a nonselective beta-adrenoceptor blocking agent and an alpha 1-adrenoceptor blocker. It can be used as a drug, belonging to the class of beta blockers, in the treatment of heart failure, coronary artery disease, and hypertension. Carvedilol has been shown to reduce the risk of death in patients with heart failure and improve symptoms. Furthermore it has an effect on blood pressure by decreasing peripheral vascular resistance and mean arterial pressure. Carvedilol can be metabolized by cytochrome P450 enzymes and CYP2D6 and CYP2C9 liver enzymes.</p>Formule :C24H26N2O4Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :406.47 g/molH-SYDL^DPGAGSLEI^-OH
<p>Peptide H-SYDL^DPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNVDEVGGEALGR^-OH
<p>Peptide H-VNVDEVGGEALGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVTQFTSWR-OH
<p>H-SVTQFTSWR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVTQFTSWR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVTQFTSWR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVTQFTSWR-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-ALDAAYCFR^-OH
<p>Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 66
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,890.3 g/molH-TFRRRLSRATR-NH2
<p>Peptide H-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CNTATCATQR^-OH
<p>Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-109
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,720 g/molH-LIYDSSLCDL^-OH
<p>Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CTL peptide epitope
<p>CTL peptide epitope (CTLp) is from human mucin-1 (MUC1). This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formule :C43H73N11O14Masse moléculaire :986.12 g/molH-RPILTIITLEDSSGNLLGR^-OH
<p>Peptide H-RPILTIITLEDSSGNLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AHQLAIDTYQEFEETYIPK^-OH
<p>Peptide H-AHQLAIDTYQEFEETYIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVLVNAIYFK^-OH
<p>Peptide H-LVLVNAIYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPIYSNNFGK^-OH
Peptide H-NPIYSNNFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RRRK-NH2
<p>Peptide Ac-RRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Purotoxin-1
CAS :<p>Purotoxin-1 is a peptide that belongs to the group of activators. It is an inhibitor of potassium channels which are involved in the regulation of excitability and repolarization of cells. Purotoxin-1 has been shown to block the binding of calcium ions to the N-type voltage-gated calcium channels, leading to decreased intracellular calcium levels and reduced neurotransmitter release. Purotoxin-1 has been shown to inhibit tumor growth in vivo, which may be due to its ability to inhibit protein interactions with cell surface receptors.</p>Formule :C155H248N50O48S8Degré de pureté :Min. 95%Masse moléculaire :3,836.5 g/molBiot-DENPVVHFFKNIVTPRTPP-NH2
<p>Peptide Biot-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NYTAPGGGQFTLPGR^-OH
<p>Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CVSGWRLFKKIS-NH2
<p>Peptide Ac-CVSGWRLFKKIS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTLIIYLDK^-OH
<p>Peptide H-NTLIIYLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-QTSSPNTGKTSTISTT-NH2
<p>Peptide Biot-QTSSPNTGKTSTISTT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Venetoclax
CAS :<p>A BCL-2 selective inhibitor with no effect on Bcl-xl and thereby prevents thrombocytopenia. Increased sensitivity observed in Bcl-2-dependent haematological tumour cell lines. Elicits additional benefits to tamoxifen treatment in ER-positive breast cancer xenografts.</p>Formule :C45H50ClN7O7SDegré de pureté :Min. 98 Area-%Couleur et forme :Yellow PowderMasse moléculaire :868.44 g/molH-AYLKTNVFL-OH
<p>H-AYLKTNVFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AYLKTNVFL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AYLKTNVFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AYLKTNVFL-OH at the technical inquiry form on this page</p>Degré de pureté :Min. 95%H-VVVGAGDVGK^-OH
<p>Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATFNPAQDK^-OH
<p>Peptide H-ATFNPAQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-YG-OH
<p>Peptide Fluor-YG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYTLVLTDPDAPSR^-OH
<p>Peptide H-LYTLVLTDPDAPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5FAM-EDIIRNIARHLAQVGDSMDR-OH
<p>Peptide 5FAM-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>C.I.Direct Black 155
CAS :<p>Please enquire for more information about C.I.Direct Black 155 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%SIVmac239 - 50
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,715 g/molBorrelia Burgdorferi Sensu Stricto Flagellin p41, Recombinant
<p>Borrelia Burgdorferi Sensu Stricto Flagellin p41, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Borrelia Burgdorferi Sensu Stricto Flagellin p41, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KIRLRPGGK-NH2
<p>Peptide Ac-KIRLRPGGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C56H92N14O20SMasse moléculaire :1,313.5 g/molH-YPDAVATWLNPDPSQK^-OH
Peptide H-YPDAVATWLNPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
