CymitQuimica logo
Produits biochimiques et réactifs

Produits biochimiques et réactifs

Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.

Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"

130581 produits trouvés pour "Produits biochimiques et réactifs"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • H-EFTVSLHLAR-OH


    <p>H-EFTVSLHLAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EFTVSLHLAR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EFTVSLHLAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EFTVSLHLAR-OH at the technical inquiry form on this page</p>
    Degré de pureté :Min. 95%

    Ref: 3D-VAB-01818

    1mg
    246,00€
  • β-Ala-Lys(AMCA)

    CAS :
    <p>β-Ala-Lys(AMCA) is a peptide that can inhibit the interactions of proteins. β-Ala-Lys(AMCA) is an inhibitor of protein interactions and can be used as a research tool to study the interactions between proteins. β-Ala-Lys(AMCA) has been shown to activate certain receptors, such as the receptor for angiotensin II, and can be used to increase or decrease the activity of ligands. This drug also has a high purity level, which makes it suitable for use in life science research.</p>
    Formule :C21H28N4O6
    Degré de pureté :Min. 95%
    Masse moléculaire :432.47 g/mol

    Ref: 3D-PBP-3412-V

    1mg
    269,00€
    2mg
    375,00€
    5mg
    617,00€
    500µg
    182,00€
  • Ac-CAQAGLKPEQA-NH2


    <p>Peptide Ac-CAQAGLKPEQA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46940

    ne
    À demander
  • H-VTDALNATR^-OH


    <p>Peptide H-VTDALNATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40241

    ne
    À demander
  • H-EGLELPEDEEEK^-OH


    <p>Peptide H-EGLELPEDEEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41521

    ne
    À demander
  • Tropisetron hydrochloride

    CAS :
    <p>5-HT3 receptor antagonist; alpha-7 nicotinic acetylcholine receptor partial agonist</p>
    Formule :C17H20N2O2•HCl
    Degré de pureté :Min. 95%
    Masse moléculaire :320.81 g/mol

    Ref: 3D-FT28617

    10mg
    135,00€
    50mg
    196,00€
  • H-DPGVLDR^-OH


    <p>Peptide H-DPGVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42131

    ne
    À demander
  • Camstatin

    CAS :
    <p>Camstatin is an adjuvant therapy that has been shown to inhibit the activation of protein kinase A (PKA) in cells. It also inhibits phosphorylation of the cAMP-dependent protein kinase, which leads to a potentiation of effects. Camstatin also has a potent inhibitory effect on cellular protein synthesis and phosphate uptake. Camstatin can be used as an inhibitor of the phosphodiesterase enzyme, which is involved in the hydrolysis of intracellular cyclic nucleotides. This prevents the breakdown of cAMP and therefore increases its concentration in the cell and activates PKA.</p>
    Formule :C122H203N39O34
    Degré de pureté :Min. 95%
    Masse moléculaire :2,760.2 g/mol

    Ref: 3D-CQB29595

    ne
    À demander
  • H-ELNRKMIYM-OH


    <p>H-ELNRKMIYM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ELNRKMIYM-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ELNRKMIYM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ELNRKMIYM-OH at the technical inquiry form on this page</p>
    Degré de pureté :Min. 95%

    Ref: 3D-VAB-00884

    1mg
    246,00€
  • H-TLTLFNVTR^-OH


    <p>Peptide H-TLTLFNVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42533

    ne
    À demander
  • H-EFTPVL^QADFQK-OH


    <p>Peptide H-EFTPVL^QADFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42085

    ne
    À demander
  • H-FLLTKILTI^-OH


    <p>Peptide H-FLLTKILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41141

    ne
    À demander
  • H-VGVNGF^G^R-OH


    <p>Peptide H-VGVNGF^G^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48674

    ne
    À demander
  • Ala-Val-Ile


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C14H27N3O4
    Masse moléculaire :301.38 g/mol

    Ref: 3D-PP50636

    ne
    À demander
  • Carvedilol - Bio-X ™

    Produit contrôlé
    CAS :
    <p>Carvediol is a nonselective beta-adrenoceptor blocking agent and an alpha 1-adrenoceptor blocker. It can be used as a drug, belonging to the class of beta blockers, in the treatment of heart failure, coronary artery disease, and hypertension. Carvedilol has been shown to reduce the risk of death in patients with heart failure and improve symptoms. Furthermore it has an effect on blood pressure by decreasing peripheral vascular resistance and mean arterial pressure. Carvedilol can be metabolized by cytochrome P450 enzymes and CYP2D6 and CYP2C9 liver enzymes.</p>
    Formule :C24H26N2O4
    Degré de pureté :Min. 98 Area-%
    Couleur et forme :Powder
    Masse moléculaire :406.47 g/mol

    Ref: 3D-BC164291

    50mg
    135,00€
  • H-SYDL^DPGAGSLEI^-OH


    <p>Peptide H-SYDL^DPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46775

    ne
    À demander
  • H-VNVDEVGGEALGR^-OH


    <p>Peptide H-VNVDEVGGEALGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48897

    ne
    À demander
  • H-SVTQFTSWR-OH


    <p>H-SVTQFTSWR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVTQFTSWR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVTQFTSWR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVTQFTSWR-OH at the technical inquiry form on this page</p>
    Degré de pureté :Min. 95%

    Ref: 3D-VAB-01496

    1mg
    246,00€
  • H-ALDAAYCFR^-OH


    <p>Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49199

    ne
    À demander
  • SIVmac239 - 66


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,890.3 g/mol

    Ref: 3D-PP50136

    ne
    À demander
  • H-TFRRRLSRATR-NH2


    <p>Peptide H-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43767

    ne
    À demander
  • H-CNTATCATQR^-OH


    <p>Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42591

    ne
    À demander
  • HXB2 gag NO-109


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,720 g/mol

    Ref: 3D-PP49975

    ne
    À demander
  • H-LIYDSSLCDL^-OH


    <p>Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47551

    ne
    À demander
  • CTL peptide epitope


    <p>CTL peptide epitope (CTLp) is from human mucin-1 (MUC1). This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
    Formule :C43H73N11O14
    Masse moléculaire :986.12 g/mol

    Ref: 3D-PP51331

    1mg
    182,00€
    5mg
    341,00€
  • H-RPILTIITLEDSSGNLLGR^-OH


    <p>Peptide H-RPILTIITLEDSSGNLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42071

    ne
    À demander
  • H-AHQLAIDTYQEFEETYIPK^-OH


    <p>Peptide H-AHQLAIDTYQEFEETYIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41363

    ne
    À demander
  • H-LVLVNAIYFK^-OH


    <p>Peptide H-LVLVNAIYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41939

    ne
    À demander
  • H-NPIYSNNFGK^-OH


    Peptide H-NPIYSNNFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41307

    ne
    À demander
  • Ac-RRRK-NH2


    <p>Peptide Ac-RRRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44407

    ne
    À demander
  • Purotoxin-1

    CAS :
    <p>Purotoxin-1 is a peptide that belongs to the group of activators. It is an inhibitor of potassium channels which are involved in the regulation of excitability and repolarization of cells. Purotoxin-1 has been shown to block the binding of calcium ions to the N-type voltage-gated calcium channels, leading to decreased intracellular calcium levels and reduced neurotransmitter release. Purotoxin-1 has been shown to inhibit tumor growth in vivo, which may be due to its ability to inhibit protein interactions with cell surface receptors.</p>
    Formule :C155H248N50O48S8
    Degré de pureté :Min. 95%
    Masse moléculaire :3,836.5 g/mol

    Ref: 3D-PPT-4457-S

    100µg
    732,00€
  • Biot-DENPVVHFFKNIVTPRTPP-NH2


    <p>Peptide Biot-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP43503

    ne
    À demander
  • H-NYTAPGGGQFTLPGR^-OH


    <p>Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40717

    ne
    À demander
  • Ac-CVSGWRLFKKIS-NH2


    <p>Peptide Ac-CVSGWRLFKKIS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP46980

    ne
    À demander
  • H-NTLIIYLDK^-OH


    <p>Peptide H-NTLIIYLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48442

    ne
    À demander
  • Biot-QTSSPNTGKTSTISTT-NH2


    <p>Peptide Biot-QTSSPNTGKTSTISTT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44893

    ne
    À demander
  • Venetoclax

    CAS :
    <p>A BCL-2 selective inhibitor with no effect on Bcl-xl and thereby prevents thrombocytopenia. Increased sensitivity observed in Bcl-2-dependent haematological tumour cell lines. Elicits additional benefits to tamoxifen treatment in ER-positive breast cancer xenografts.</p>
    Formule :C45H50ClN7O7S
    Degré de pureté :Min. 98 Area-%
    Couleur et forme :Yellow Powder
    Masse moléculaire :868.44 g/mol

    Ref: 3D-FV63222

    1g
    940,00€
    2g
    974,00€
    100mg
    255,00€
    250mg
    430,00€
    500mg
    598,00€
  • H-AYLKTNVFL-OH


    <p>H-AYLKTNVFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AYLKTNVFL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AYLKTNVFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AYLKTNVFL-OH at the technical inquiry form on this page</p>
    Degré de pureté :Min. 95%

    Ref: 3D-VAB-00799

    1mg
    246,00€
  • H-VVVGAGDVGK^-OH


    <p>Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP49235

    ne
    À demander
  • H-ATFNPAQDK^-OH


    <p>Peptide H-ATFNPAQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42423

    ne
    À demander
  • Fluor-YG-OH


    <p>Peptide Fluor-YG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP44832

    ne
    À demander
  • H-LYTLVLTDPDAPSR^-OH


    <p>Peptide H-LYTLVLTDPDAPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41153

    ne
    À demander
  • 5FAM-EDIIRNIARHLAQVGDSMDR-OH


    <p>Peptide 5FAM-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP48318

    ne
    À demander
  • C.I.Direct Black 155

    CAS :
    <p>Please enquire for more information about C.I.Direct Black 155 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>
    Degré de pureté :Min. 95%

    Ref: 3D-FD41361

    ne
    À demander
  • SIVmac239 - 50


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Masse moléculaire :1,715 g/mol

    Ref: 3D-PP50192

    ne
    À demander
  • Borrelia Burgdorferi Sensu Stricto Flagellin p41, Recombinant


    <p>Borrelia Burgdorferi Sensu Stricto Flagellin p41, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Borrelia Burgdorferi Sensu Stricto Flagellin p41, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

    Ref: 3D-AG6223_0.1MG

    ne
    À demander
  • H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH


    <p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47267

    ne
    À demander
  • Ac-KIRLRPGGK-NH2


    <p>Peptide Ac-KIRLRPGGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP45697

    ne
    À demander
  • H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formule :C56H92N14O20S
    Masse moléculaire :1,313.5 g/mol

    Ref: 3D-PP50786

    ne
    À demander
  • H-YPDAVATWLNPDPSQK^-OH


    Peptide H-YPDAVATWLNPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45649

    ne
    À demander