CymitQuimica logo
Produits biochimiques et réactifs

Produits biochimiques et réactifs

Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.

Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"

130507 produits trouvés pour "Produits biochimiques et réactifs"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • STAT5A antibody (Tyr694)


    Rabbit polyclonal STAT5A antibody (Tyr694)

    Ref: 3D-70R-32520

    100µg
    502,00€
  • Macitentan - Bio-X ™

    CAS :
    Macitentan is an endothelial receptor antagonist that is used in the management of pulmonary arterial hypertension in order to delay progression of disease. This drug binds to endothelial receptors blocking signalling from endothelial -1 and -2.
    Formule :C19H20Br2N6O4S
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :588.27 g/mol

    Ref: 3D-BM162771

    10mg
    151,00€
  • Folic acid-BSA


    Folic acid-BSA is a Hapten Conjugate that consists of folic acid conjugated to bovine serum albumin (BSA). It is commonly used in various research applications in the field of Life Sciences. Folic acid-BSA can be utilized as an antigen to generate monoclonal antibodies specific to folic acid. These antibodies can then be employed in immunoassays, such as ELISA, for the detection and quantification of folic acid in biological samples. Additionally, folic acid-BSA has been used as a carrier protein for the development of DNA vaccines. By conjugating folic acid to BSA, it enhances the immunogenicity of the DNA vaccine and promotes a stronger immune response. This approach has shown promising results in preclinical studies, demonstrating its potential for future use in vaccine development. Furthermore, folic acid-BSA has been utilized in electrode-based assays for the detection of biomolecules. The conjugate acts as a

    Ref: 3D-80-1072

    1mg
    706,00€
  • H-ILFLSLLRPVLK-OH


    H-ILFLSLLRPVLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ILFLSLLRPVLK-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ILFLSLLRPVLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ILFLSLLRPVLK-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-02702

    1mg
    346,00€
  • H-REEE-NH2


    Peptide H-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48987

    ne
    À demander
  • H-MVYISNVSKLCFSKM-OH


    H-MVYISNVSKLCFSKM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MVYISNVSKLCFSKM-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MVYISNVSKLCFSKM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MVYISNVSKLCFSKM-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-04875

    1mg
    346,00€
  • H-YNWNSFGLRF-NH2


    Peptide H-YNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40104

    ne
    À demander
  • Human-24, human

    CAS :
    This antibody is a mouse IgG2a monoclonal antibody to human 24, a protein of unknown function. It blocks the binding of this protein to its ligand, inhibiting the function of this protein.
    Degré de pureté :Min. 95%

    Ref: 3D-FH156870

    ne
    À demander
  • H-VHGLEIQGR^-OH


    Peptide H-VHGLEIQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49654

    ne
    À demander
  • CMVpp65 - 19 (NQLQVQHTYFTGSEV)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,750.9 g/mol

    Ref: 3D-PP50953

    ne
    À demander
  • SIVmac239 - 98


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Masse moléculaire :1,657.9 g/mol

    Ref: 3D-PP50351

    ne
    À demander
  • TSH antibody


    TSH antibody was raised in mouse using human TSH beta as the immunogen.

    Ref: 3D-10C-CR2151M3

    1mg
    355,00€
  • CMVpp65 - 60 (SGKLFMHVTLGSDVE)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Masse moléculaire :1,619.9 g/mol

    Ref: 3D-PP50993

    ne
    À demander
  • VH 298

    CAS :
    A selective VHL inhibitor that stabilizes the hydroxylated form of HIF-α, resulting in upregulation of downstream target genes and proteins. Provides a tool for studying hypoxic signaling pathway.
    Formule :C27H33N5O4S
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :523.65 g/mol

    Ref: 3D-BV165083

    10mg
    342,00€
    50mg
    954,00€
  • H-TVGDVVAYIQK^-OH


    Peptide H-TVGDVVAYIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40753

    ne
    À demander
  • H-QFTSWRCTR-OH


    H-QFTSWRCTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QFTSWRCTR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QFTSWRCTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QFTSWRCTR-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-01356

    1mg
    246,00€
  • H-Cys-Gly-OH

    CAS :
    H-Cys-Gly-OH is a cyclic peptide that has potent antitumor activity. It was synthesized from glutathione and cysteine, which are naturally occurring amino acids in the human body. The mechanism of action of H-Cys-Gly-OH is not well understood, but it may be due to its ability to bind to α1-acid glycoprotein and other proteins in the blood. The compound also has a redox potential, fluorescence spectra, and structural analysis that can be used for identification purposes. This molecule is stable at acid pH and is easily soluble in water or organic solvents. H-Cys-Gly-OH can be analyzed by titration calorimetry or cyclic voltammetry methods.
    Formule :C5H10N2O3S
    Degré de pureté :Min. 95%
    Masse moléculaire :178.21 g/mol

    Ref: 3D-FC108250

    10mg
    213,00€
    25mg
    399,00€
    50mg
    569,00€
    100mg
    841,00€
  • H-IVTLISFGAFVAK^-OH


    Peptide H-IVTLISFGAFVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41523

    ne
    À demander
  • LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2


    Peptide LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49767

    ne
    À demander
  • H-VLAFGFAL-OH


    H-VLAFGFAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLAFGFAL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLAFGFAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLAFGFAL-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-00691

    1mg
    246,00€
  • BRLF1 109-117 (HLA-A*02:01)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Ref: 3D-PP50772

    ne
    À demander
  • α Synuclein antibody


    Alpha Synuclein antibody was raised in goat using a peptide; MPVDPDNEAYEMPSEE, as the immunogen.
    Degré de pureté :Min. 95%

    Ref: 3D-20-SG70

    100µl
    183,00€
  • Dengue virus antibody


    Dengue virus antibody is a monoclonal antibody that specifically targets the glycoprotein antigen of the dengue virus. This antibody is produced using advanced techniques in the field of Life Sciences. It has been shown to effectively bind to and neutralize the dengue virus, preventing its replication and spread within the body. The Dengue virus antibody has high specificity and affinity for the viral glycoproteins, making it a valuable tool for research and diagnostic purposes. It can be used in various applications, including immunohistochemistry, ELISA assays, and Western blotting. The antibody is stable in both methanol and butanol solutions, allowing for flexible experimental conditions. With its ability to recognize different serotypes of the dengue virus, this monoclonal antibody provides a reliable means of detecting and studying this infectious pathogen.

    Ref: 3D-10-1435

    100µg
    458,00€
  • H-LLIYDTSK-OH


    H-LLIYDTSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLIYDTSK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLIYDTSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLIYDTSK-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-00596

    1mg
    246,00€
  • H-MREGVELCPGNKYEMRRHGT-OH


    H-MREGVELCPGNKYEMRRHGT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MREGVELCPGNKYEMRRHGT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MREGVELCPGNKYEMRRHGT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MREGVELCPGNKYEMRRHGT-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-07590

    1mg
    461,00€
  • 4,4'-Dimethoxytrityl chloride

    CAS :
    4,4'-Dimethoxytrityl chloride is a versatile compound used in oligonucleotide synthesis as a protecting group. It selectively reacts with thiol groups, allowing for the selective deprotection of nucleosides. This compound can also be used as a calcium scavenger and has been shown to inhibit the formation of d-glucaric acid, which is involved in the metabolism of triptolide. Additionally, 4,4'-Dimethoxytrityl chloride can react with primary alcohols to form esters, making it useful in organic synthesis. It has also been used as an opioid antagonist and has been shown to enhance the stability of sodium perborate in cosmetic formulations.
    Formule :C21H19ClO2
    Degré de pureté :Min. 98 Area-%
    Couleur et forme :Powder
    Masse moléculaire :338.83 g/mol

    Ref: 3D-FD02569

    250g
    275,00€
    500g
    457,00€
    1kg
    741,00€
    2kg
    1.216,00€
    5kg
    2.754,00€
  • Human Papillomavirus E7 protein (49 - 57)

    CAS :
    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C52H77N15O13
    Masse moléculaire :1,120.29 g/mol

    Ref: 3D-PP50750

    ne
    À demander
  • LCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2


    Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47142

    ne
    À demander
  • FALL-39


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C217H354N62O55
    Masse moléculaire :24.7 g/mol

    Ref: 3D-PP50520

    ne
    À demander
  • LCBiot-PQDKEYYKVKE-OH


    Peptide LCBiot-PQDKEYYKVKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47662

    ne
    À demander
  • Human Nasal Dry Swab from Patient with Respiratory Symptoms


    Human Nasal Dry Swab from Patient with Respiratory Symptoms is an antigen for use in IVD applications. Please enquire for more information about Human Nasal Dry Swab from Patient with Respiratory Symptoms including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CR8483

    ne
    À demander
  • H-IPPYLFT-OH


    H-IPPYLFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IPPYLFT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IPPYLFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IPPYLFT-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-00315

    1mg
    246,00€
  • tTG/DGP IgA/IgG Positive Human Plasma


    tTG/DGP IgA/IgG Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about tTG/DGP IgA/IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CX5657

    ne
    À demander
  • H-SQTANLTSR-OH


    H-SQTANLTSR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SQTANLTSR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SQTANLTSR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SQTANLTSR-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-01479

    1mg
    246,00€
  • GLS antibody


    GLS antibody was raised using the middle region of GLS corresponding to a region with amino acids VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
    Degré de pureté :Min. 95%

    Ref: 3D-70R-5477

    100µl
    828,00€
  • H-GLEWVGWINTYTGEPTYAADFK^-OH


    Peptide H-GLEWVGWINTYTGEPTYAADFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48880

    ne
    À demander
  • H-YISFQNPRTVPVQPAFST-OH


    H-YISFQNPRTVPVQPAFST-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YISFQNPRTVPVQPAFST-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YISFQNPRTVPVQPAFST-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YISFQNPRTVPVQPAFST-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-07060

    1mg
    461,00€
  • H-VIGQGQQPSTAAR-OH


    H-VIGQGQQPSTAAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VIGQGQQPSTAAR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VIGQGQQPSTAAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VIGQGQQPSTAAR-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-03136

    1mg
    346,00€
  • H-LLIIGASTR^-OH


    Peptide H-LLIIGASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40435

    ne
    À demander
  • Mycophenolate mofetil - Bio-X ™

    CAS :
    Mycophenolate mofetil is an immunosuppressive drug that is used to prevent rejections after organ transplants. This drug inhibits inosine monophosphate dehydrogenase and interferes with the de novo pathway of guanosine nucleotide synthesis without incorporation into DNA. It also prevents antibody formation.
    Formule :C23H31NO7
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :433.49 g/mol

    Ref: 3D-BM164622

    100mg
    135,00€
  • Fmoc-β-(7-methoxy-coumarin-4-yl)-Ala-OH

    CAS :
    Fmoc-b-(7-methoxy-coumarin-4-yl)-Ala-OH is a reagent with the CAS No. 524698-40-6, which is used in organic synthesis. It is a versatile building block and useful intermediate that can be used to synthesize other organic compounds. Fmoc-b-(7-methoxy-coumarin-4-yl)-Ala-OH is also used as a reaction component in the synthesis of peptides and proteins, as well as in the preparation of polymers. It has been shown to be an effective building block for complex compounds.
    Formule :C28H23NO7
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :485.48 g/mol

    Ref: 3D-FF111350

    25mg
    191,00€
    50mg
    270,00€
    100mg
    407,00€
    250mg
    741,00€
  • H-CGGANTVSANTVSANTVS-OH


    H-CGGANTVSANTVSANTVS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGANTVSANTVSANTVS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGANTVSANTVSANTVS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGANTVSANTVSANTVS-OH at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-06712

    1mg
    461,00€
  • SARS-CoV-2 Antibody Positive Human Plasma


    SARS-CoV-2 Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about SARS-CoV-2 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BA5739

    ne
    À demander
  • Suc-Ala-Ala-Pro-Val-pNA

    CAS :
    Suc-Ala-Ala-Pro-Val-pNA is a synthetic peptide that is used as a research tool to study neutrophil function. It has been shown to have a dose response curve and can be hydrolyzed by esterases. Suc-Ala-Ala-Pro-Val-pNA can also inhibit the activity of proteolytic enzymes, such as kallikrein and pancreatic elastase, and has an absorption maximum at 270 nm. The sequence of this peptide was derived from sequences found in the protein maldiophorin A, which are found in molluscs.
    Formule :C26H36N6O9
    Degré de pureté :Min. 95%
    Couleur et forme :White Powder
    Masse moléculaire :576.6 g/mol

    Ref: 3D-FS110780

    50mg
    429,00€
  • C.I.Disperse Orange 70

    CAS :
    Please enquire for more information about C.I.Disperse Orange 70 including the price, delivery time and more detailed product information at the technical inquiry form on this page
    Degré de pureté :Min. 95%

    Ref: 3D-FD41416

    ne
    À demander
  • Val-Val-Val-Gly-Ala-Asp-Gly-Val-Gly-Lys


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C39H69N11O13
    Masse moléculaire :900.03 g/mol

    Ref: 3D-PP50790

    ne
    À demander
  • Histatin 5

    CAS :
    Peptide Histatin 5 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formule :C133H195N51O33
    Masse moléculaire :3,036.36 g/mol

    Ref: 3D-PP49102

    ne
    À demander
  • Nicardipine HCl - Bio-X ™

    CAS :
    Nicardipine is calcium channel blocker drug that is used for the treatment of hypertension and angina. This drug can also be used in the treatment of asthma and is said to enhance the action of various antineoplastic agents.
    Formule :C26H29N3O6•HCl
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :515.99 g/mol

    Ref: 3D-BN166182

    100mg
    135,00€
  • Ac-CEVSKPGRQHPKRVSR-NH2


    Ac-CEVSKPGRQHPKRVSR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CEVSKPGRQHPKRVSR-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CEVSKPGRQHPKRVSR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CEVSKPGRQHPKRVSR-NH2 at the technical inquiry form on this page

    Degré de pureté :Min. 95%

    Ref: 3D-VAB-06516

    1mg
    461,00€
  • Atomoxetine hydrochloride - Bio-X ™

    Produit contrôlé
    CAS :
    Atomoxetine is a selective norepinephrine reuptake inhibitor. It is used to treat attention deficit hyperactivity disorder (ADHD) in children and adults, as well as major depressive disorder in adults. This drug prevents the reuptake of the neurotransmitter norepinephrine which aids in improving the symptoms of ADHD.
    Formule :C17H22ClNO
    Degré de pureté :Min. 95%
    Couleur et forme :White Powder
    Masse moléculaire :291.82 g/mol

    Ref: 3D-BM164222

    50mg
    158,00€