Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.559 produits)
- Par Biological Target(101.029 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Haemoglobin A1C (HbA1c) Mouse Monoclonal Antibody
Haemoglobin A1C (HbA1c) Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Haemoglobin A1C (HbA1c) Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.
H-GEAGPQGPR^-OH
Peptide H-GEAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KEKIEELQQ-OH
H-KEKIEELQQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KEKIEELQQ-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KEKIEELQQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KEKIEELQQ-OH at the technical inquiry form on this page
Degré de pureté :Min. 95%Podoplanin antibody
Podoplanin antibody was raised in rabbit using recombinant ectodomain of human gp36 (podoplanin) as the immunogen.Degré de pureté :Min. 95%Ac-CR-NH2
Peptide Ac-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NEEGAPQEGILEDMPVDPD-OH
H-NEEGAPQEGILEDMPVDPD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NEEGAPQEGILEDMPVDPD-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NEEGAPQEGILEDMPVDPD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NEEGAPQEGILEDMPVDPD-OH at the technical inquiry form on this page
Degré de pureté :Min. 95%Ac-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2
Ac-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 is a peptide that is a melanocortin receptor agonist. It has been shown to have biochemically active properties and can be used as a research tool in the study of peptides and their receptors.Degré de pureté :Min. 95%Dengue NS1 antibody
The Dengue NS1 antibody is a highly specialized product in the field of Life Sciences. It is a Monoclonal Antibody that targets the glycan present on the NS1 protein of the dengue virus. This antibody has been extensively used in research and diagnostic applications, particularly in the development of ophthalmic formulations for dengue-related eye diseases. The Dengue NS1 antibody has shown promising results in inhibiting the interaction between NS1 and host cell receptors, thereby preventing viral entry and replication. Additionally, it has demonstrated its efficacy in neutralizing the harmful effects of NS1, such as its interference with epidermal growth factor and erythropoietin signaling pathways. Studies have also revealed that this antibody can effectively inhibit angiogenesis by reducing microvessel density through its interaction with specific growth factors involved in blood vessel formation. Furthermore, it has been found to modulate immune responses by blocking the activity of pro-inflammatory biomolecules like TNF-α and chemokinesZnT-8 114-123 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFGF 2 Mouse
FGF-2 is a protein that belongs to the FGF family. It is an activator of erythropoietin, which stimulates the production of red blood cells. FGF-2 also acts as a ligand for FGFR1 and FGFR2, which are receptors for FGF-2. The binding of FGF-2 to these receptors leads to a cascade of cellular responses by activating different types of ion channels and proteins involved in cell proliferation and differentiation. This protein is purified from mouse sources with high purity and no detectable endotoxin levels.Degré de pureté :Min. 95%H-D-Glu(Gly-OH)-OH
CAS :H-D-Glu(Gly-OH)-OH is a peptide that is used to study the mechanism of glutamate receptors. It has been shown to have an excitatory effect on mouse hippocampal and cerebellar purkinje neurons, with affinity values for membrane channels. It also has been shown to reduce gamma-aminobutyric acid (GABA) levels in the hippocampus and striatum, which may be due to its ability to inhibit glutamic acid decarboxylase. H-D-Glu(Gly-OH)-OH is a potent antagonist of glutamate, binding competitively at the glutamate site on ionotropic receptors. It also inhibits acidic pH and calcium ion concentrations, which are necessary for ionotropic receptor activation.Formule :C7H12N2O5Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :204.18 g/molH-LIAPVAEEEATVPNNK^-OH
Peptide H-LIAPVAEEEATVPNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGKLSKIWDLPL^DE-OH
Peptide H-MGKLSKIWDLPL^DE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dopamine HCl - Bio-X ™
CAS :Dopamine is a catecholamine neurotransmitter that is used to treat hemodynamic balances, poor perfusion of organs and hypotension. This neurotransmitter is derived from tyrosine and is important in regulating movement. Dopamine produces positive chronotropic and inotropic effects on the myocardium, resulting in increased heart rate and cardiac contractility.Formule :C8H11NO2•HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :189.64 g/molH-LGEYGFQNAL^-OH
Peptide H-LGEYGFQNAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Met-Leu-pNA (Hydrochloride Form)
Met-Leu-pNA (Hydrochloride Form) is a peptide that binds with high affinity to the N-methyl-D-aspartate receptor, an ion channel protein. It is used in research tools and as an inhibitor. The peptide has been shown to inhibit the activity of the receptor by competitive inhibition, preventing binding of glutamate, which normally activates the ion channel. This inhibition leads to a decrease in neuronal excitability and decreased production of proinflammatory cytokines.Formule :C17H26N4O4S•HClDegré de pureté :Min. 95%Masse moléculaire :418.95 g/molH-NPANPV^QR-OH
Peptide H-NPANPV^QR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MASMTGGQQMGR^-OH
Peptide H-MASMTGGQQMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
D-Dimer antibody
D-Dimer antibody was raised in mouse using homogenized fibrin clot D-dimer or high molecular weight fibrin degradation products as the immunogen.Nizatidine - Bio-X ™
CAS :Nizatidine is a histamine H2 receptor antagonist that is used to treat GERD and a variety of ulcers. Competitive inhibition of H2 receptors results in reduction of basal and nocturnal gastric acid secretions. This drug also decreases the gastric acid response to stimuli such as food and caffeine.Formule :C12H21N5O2S2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :331.46 g/molCA 72-4 (Low Cross-reactivity), Part Purified
CA 72-4 (Low Cross-reactivity), Part Purified is a life science tool for use in IVD applications. Please enquire for more information about CA 72-4 (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.Degré de pureté :SpecificationCollagen Type II antibody
Collagen type II antibody was raised in rabbit using collagen type II from human knee cartilage and bovine nasal cartilage as the immunogen.H-IQEVAGSLIFR^-OH
Peptide H-IQEVAGSLIFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMV IgM seroconversion panel 2
CMV IgM seroconversion panel 2 is a life science tool for use in IVD applications. Please enquire for more information about CMV IgM seroconversion panel 2 including the price, delivery time and more detailed product information at the technical inquiry form on this page.Dengue Virus Type 2 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 2 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :≥95% On 12.5% By Sds-Page. Single Band Visible At Approximately 50 Kda.H-ALPNNTSSSPQPK^-OH
Peptide H-ALPNNTSSSPQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGPASALCA-OH
H-SGPASALCA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGPASALCA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGPASALCA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGPASALCA-OH at the technical inquiry form on this page
Degré de pureté :Min. 95%Ac-AGFAGDDAP-NH2
Peptide Ac-AGFAGDDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Glu(OtBu)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-D-Glu(OtBu)-Wang resin is a solid support for peptide synthesis. It is used to synthesize peptides with the Fmoc or O-benzyl protecting group. The resin has a 1% DVB content and an average particle size of 100-200 mesh.Degré de pureté :Min. 95%Dnp-Gly-Pro-Leu-Gly-Met-Arg-Gly-Leu-NH2
This peptide is a collagenase, MMP-13 and stromelysin substrate. It can be used as a biochemical in enzyme assays to measure the activity of collagenases and MMPs.
Formule :C40H64N14O12SDegré de pureté :Min. 95%Masse moléculaire :965.11 g/molAc-Pro-Arg-Asn-Lys-Acc-NH2
Ac-Pro-Arg-Asn-Lys-Acc-NH2 is a peptide that is used to study the catalytic mechanism of enzymes. It has been shown to be an effective substrate for tryptase, which is an enzyme that plays a role in the degradation of proteins. Ac-Pro-Arg-Asn-Lys-Acc-NH2 binds to the active site of tryptase and undergoes a series of reactions that lead to its hydrolysis. The rate constants for these reactions have been measured in order to determine kinetic constants.Formule :C34H49N11O9Degré de pureté :Min. 95%Masse moléculaire :755.84 g/molH-AQSKPER^-OH
Peptide H-AQSKPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 170
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,897.4 g/molH-A^VLQ-OH
Peptide H-A^VLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALGTEVIQLFPEK^-OH
Peptide H-ALGTEVIQLFPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Adipophilin antibody
Adipophilin antibody was raised in guinea pig using a synthetic peptide corresponding to residues 1-29 of the N-terminus of human and murine adipophilin as the immunogen.H-LRRNKVGRNNEKLPT-OH
H-LRRNKVGRNNEKLPT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LRRNKVGRNNEKLPT-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LRRNKVGRNNEKLPT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LRRNKVGRNNEKLPT-OH at the technical inquiry form on this page
Degré de pureté :Min. 95%Pipethanate ethobromide
CAS :Prostaglandin E2 (EP2) receptor antagonistFormule :C23H30NO3•BrDegré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :448.39 g/molSLIT3 antibody
SLIT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV
Degré de pureté :Min. 95%Betulin
CAS :Produit contrôléBetulin is a natural compound found in the bark of the birch tree. It has potent angiogenic properties and induces the growth of new blood vessels. Betulin also has anti-inflammatory activity and has been shown to inhibit the production of pro-inflammatory cytokines, such as TNF-α, IL-1β, and IL-6. Betulin is a potent inducer of apoptosis in human cancer cells. It also inhibits the mitochondrial membrane potential, which results in cell death. This drug also appears to have an effect on oral pathogens by reducing their virulence and ability to adhere to epithelial cells. In addition, betulin can be used as an analytical reference standard for preparative high performance liquid chromatography (HPLC). Experimental studies have shown that betulin interacts with drugs that are metabolized by cytochrome P450 enzymes.Formule :C30H50O2Degré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :442.72 g/molAtezolizumab
CAS :Monoclonal antibody against PDL-1; anti-cancer agent
Degré de pureté :Min. 95%Couleur et forme :Clear LiquidEculizumab 10.0± 1.0mg/ml solution
CAS :Monoclonal antibody against complement protein C5Degré de pureté :Min 95%Couleur et forme :PowderH-EDLNENVPPVSFWR-OH
H-EDLNENVPPVSFWR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EDLNENVPPVSFWR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EDLNENVPPVSFWR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EDLNENVPPVSFWR-OH at the technical inquiry form on this page
Degré de pureté :Min. 95%CMVpp65 - 62 (TLGSDVEEDLTMTRN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,680.8 g/molOleoyl-L-a-lysophosphatidic acid sodium salt - Bio-X ™
CAS :OLA is an endogenous agonist of the lysophospholipid receptors LPA1 and LPA2. This chemical compound inhibits differentiation of neural stem cells into neurons.Formule :C21H40NaO7PDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :458.5 g/molLercanidipine HCl - Bio-X ™
CAS :Lercanidipine is a calcium channel blocker that is used for the treatment of hypertension. This drug inhibits ion channels and interferes with the release of calcium from the sarcoplasmic reticulum. As a result, coronary and systemic arteries are dilated, allowing for an increased supply of oxygen to myocardial tissue. .Formule :C36H41N3O6•HClDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :648.19 g/molFlunarizine dihydrochloride - Bio-X ™
CAS :Flunarizine is calcium channel blocker that helps to reduce muscle spasms. It shows antimigraine and anticonvulsive activity. This occurs by inhibiting the influx of extracellular calcium through myocardial and vascular membrane pores by physically inhibiting the voltage-dependent calcium channels. Additionally, this drug is a D2 dopamine receptor antagonist.Formule :C26H26F2N2•(HCl)2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :477.42 g/molH-NTDNNL^AV^Y-OH
Peptide H-NTDNNL^AV^Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Darolutamide
CAS :Androgen receptor antagonist; therapy for endometriosis
Formule :C19H19ClN6O2Degré de pureté :Min. 95%Couleur et forme :White To Off-White SolidMasse moléculaire :398.86 g/molFollicle stimulating hormone
CAS :Follicle Stimulating Hormone (FSH) is a protein hormone that plays a crucial role in the reproductive cycle. It stimulates the growth and development of follicles in the ovaries, which produce estrogen and progesterone. FSH also regulates spermatogenesis in men. Studies have shown that FSH has inhibitory activity on cyclin-dependent kinases, which are enzymes that regulate the cell cycle. This inhibitory activity leads to decreased cell proliferation and growth, making it a potential treatment for cancer. In vitro studies have demonstrated its effectiveness against breast and lung cancer cells lines when combined with kinase inhibitors. Additionally, FSH has been found to stimulate protein kinase activity, which may be useful in developing therapies for other diseases such as diabetes and osteoporosis.Degré de pureté :Min. 95%Couleur et forme :Powder
