Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.185 produits)
- Par Biological Target(99.150 produits)
- Par usage/effets pharmacologiques(6.789 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.764 produits)
- Métabolites secondaires(14.307 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
LMP1 (156-164), IAL
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H81N13O14Masse moléculaire :1,148.34 g/mol[Des-Tyr1]-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C74H122N18O25SMasse moléculaire :1,695.97 g/molRC-160(Vapreotide)
<p>Catalogue peptide; min. 95% purity</p>Formule :C57H70N12O9S2Masse moléculaire :1,131.4 g/molP60c-src Substrate II, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formule :C33H45N6O12PMasse moléculaire :748.8 g/molNecrofibrin, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C67H112N16O25Masse moléculaire :1,541.73 g/molPancreatic Polypeptide (31-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C36H61N13O8Masse moléculaire :804 g/molLys-Bradykinin-Ser-Val-Gln-Val-Ser
<p>Catalogue peptide; min. 95% purity</p>Formule :C77H121N23O20Masse moléculaire :1,688.96 g/molDok-4 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formule :C70H101N21O18Masse moléculaire :1,524.72 g/molProsaptide 769P
<p>Catalogue peptide; min. 95% purity</p>Formule :C114H194N28O35SMasse moléculaire :2,548.98 g/mol4A/4B, 5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C49H73N11O22S3Masse moléculaire :1,264.38 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Formule :C81H126N26O21S2Masse moléculaire :1,864.2 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formule :C97H147N29O24SMasse moléculaire :2,135.50 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formule :C28H37N5O7SMasse moléculaire :587.70 g/molVA-β-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Formule :C126H188N36O37SMasse moléculaire :2,831.19 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H124N20O26Masse moléculaire :1,817.9 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Formule :C111H191N39O29S2Masse moléculaire :2,600.07 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H74N10O11SMasse moléculaire :915.17 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Formule :C112H197N39O30Masse moléculaire :2,570 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formule :C215H357N71O67SMasse moléculaire :5,040.74 g/molAGRP (54-82)
<p>Catalogue peptide; min. 95% purity</p>Formule :C137H225N39O54Masse moléculaire :3,282.47 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formule :C83H123N27O27S5Masse moléculaire :2,091.39 g/molβ-Casein (90-96)
<p>Catalogue peptide; min. 95% purity</p>Formule :C103H175N35O27SMasse moléculaire :2,367.83 g/molR-G-D-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C15H26N7O7S1Masse moléculaire :448.48 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C143H226N46O39Masse moléculaire :3,213.6 g/molPre-S1 (12-32)
<p>Catalogue peptide; min. 95% purity</p>Formule :C104H154N26O31SMasse moléculaire :2,296.61 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H86N13O22PMasse moléculaire :1,300.36 g/molSMCX (963-973) (human)
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H81N13O18Masse moléculaire :1,128.26 g/molRS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C44H85N25O15Masse moléculaire :1,204.33 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H91N21O14Masse moléculaire :1,246.45 g/mol[Ser25]-PKC (19-36) Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C93H159N35O25Masse moléculaire :2,167.52 g/molAmyloid Dan Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Formule :C185H270N48O51S2Masse moléculaire :4,046.63 g/molHIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Formule :C116H164N32O31SMasse moléculaire :2,534.86 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formule :C108H159N23O39S2Masse moléculaire :2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H76N10O20Masse moléculaire :1,185.26 g/molBiotin-Amyloid β-Protein (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formule :C213H325N57O62S2Masse moléculaire :4,740.44 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C264H406N80O77S3Masse moléculaire :6,028.72 g/molα-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H87N15O9SMasse moléculaire :1,206.53 g/molHC-067047
CAS :<p>HC-067047 is an experimental drug that has been shown to decrease the intracellular Ca2+ concentration in various cell types, including neurons. This agent also inhibits the influx of Ca2+ ions through voltage-gated channels and blocks the release of Ca2+ from intracellular stores. HC-067047 is being investigated for chronic cough as it has been shown to reduce this symptom in a guinea pig model of asthma. In vitro studies have shown that HC-067047 is not active against protozoa or bacteria but does inhibit the growth of tumor cells. The mechanism of action for HC-067047 is not fully elucidated, but it may act by inhibiting ion transport proteins such as TRPV4, Toll-like receptor, or Ryanodine receptor. HC-067047 has also been found to increase MMP9 activity and inhibit production of cytokines such as IL-6 and TNFα.</p>Formule :C26H28F3N3O2Degré de pureté :Min. 95%Masse moléculaire :471.51 g/molSaposin C12
<p>Catalogue peptide; min. 95% purity</p>Formule :C62H108N16O22Masse moléculaire :1,429.65 g/molNeo-Kyotorphin
CAS :<p>Catalogue peptide; min. 95% purity</p>Formule :C28H47N9O9Masse moléculaire :653.74 g/molN-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys
<p>Catalogue peptide; min. 95% purity</p>Formule :C43H65O7N9Masse moléculaire :824.04 g/mol[His11]Substance P
<p>Catalogue peptide; min. 95% purity</p>Formule :C64H96N20O13Masse moléculaire :1,353.60 g/molAngiotensin I-Converting Enzyme Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C24H27N3O5Masse moléculaire :437.49 g/molpro-ε-Tx1X/12
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H126N26O16Masse moléculaire :1,539.90 g/molAc-Glutamine
<p>Catalogue peptide; min. 95% purity</p>Formule :C7H12N2O4Masse moléculaire :188.18 g/molDynorphin A (9-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H85N17O14Masse moléculaire :1,184.37 g/molβ-Amyloid (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H76N16O22Masse moléculaire :1,325.32 g/molPAKtide
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H85N19O14Masse moléculaire :1,188.36 g/molβ-Amyloid (1-49)
<p>Catalogue peptide; min. 95% purity</p>Formule :C239H376N62O69SMasse moléculaire :5,253.97 g/molLaminin Penta Peptide, amide
<p>Catalogue peptide; min. 95% purity</p>Formule :C26H43N9O7Masse moléculaire :593.7 g/molMelanin Concentrating Hormone, human, mouse, rat MCH, human, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C105H160N30O26S4Masse moléculaire :2,386.83 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H79N13O17Masse moléculaire :1,182.31 g/molGW 0742
CAS :<p>Peroxisome proliferator-activated receptor PPARβ/ÎŽ agonist</p>Formule :C21H17F4NO3S2Degré de pureté :Min. 95%Masse moléculaire :471.49 g/molBiotin-Gastrin Releasing Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formule :C140H218N40O33S3Masse moléculaire :3,085.74 g/molMBP (90-106)
<p>Catalogue peptide; min. 95% purity</p>Formule :C91H143N25O23Masse moléculaire :1,955.31 g/molH-Cys(SO3H)-OH sodium salt
CAS :<p>Please enquire for more information about H-Cys(SO3H)-OH sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C3H7NO5S2·xNaDegré de pureté :Min. 98 Area-%Couleur et forme :White PowderMasse moléculaire :201.22 g/molDynorphin A amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formule :C99H156N32O22Masse moléculaire :2,146.55 g/molTRH-SH Pro
<p>Catalogue peptide; min. 95% purity</p>Formule :C48H85N21O12S2Masse moléculaire :1,212.46 g/molSartorypyrone D
CAS :<p>Sartorypyrone is active against the Gram-positive bacteria B. subtilis, K. rhizophila, and M. smegmatis</p>Formule :C26H38O4Degré de pureté :Min. 95%Masse moléculaire :414.6 g/molBig Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Feline Herpes Virus 1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Degré de pureté :Min. 95%Feline Calicivirus VP1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Degré de pureté :Min. 95%Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS :<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Formule :C32H50N4O8Degré de pureté :Min. 95%Masse moléculaire :618.76 g/mol2B/3, Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H58N14O12Masse moléculaire :949.09 g/molLys-(Tyr8)-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formule :C56H85N17O13Masse moléculaire :1,204.41 g/molFibrinopeptide B, Bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C101H154N30O36Masse moléculaire :2,364.53 g/molBiotin-Exendin 4
<p>Catalogue peptide; min. 95% purity</p>Formule :C194H296N52O62S2Masse moléculaire :4,412.96 g/molIsosulfan blue
CAS :<p>Isosulfan blue is a dye that has been used for decades to detect skin cancer in vivo. It is a synthetic compound that binds to the lymphatic system and can be used as an analytical method for detecting cancer. Isosulfan blue is excreted through the urine and can be detected by plasma mass spectrometry, making it a useful tool for assessing toxicity levels in humans. The chemical structure of Isosulfan blue is similar to many other dyes, which makes it difficult to study its toxicity in vivo.</p>Formule :C27H31N2NaO6S2Degré de pureté :Min. 95%Masse moléculaire :566.67 g/molInfluenza NP (50-57)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H65N11O15Masse moléculaire :952.04 g/molFMRF-related peptide, Lymnaea heptapeptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H59N11O9Masse moléculaire :850.00 g/molN-Hippuryl-His-Leu trifluroacetate hydrate
CAS :<p>Hippuryl-His-Leu trifluroacetate hydrate can be used as an artificial substrate for angiotensin-converting enzyme (ACE).</p>Formule :C21H27N5O5(C2F3O2)x(H2O)xDegré de pureté :Min. 95%Masse moléculaire :429.47 g/mola2b1Integrin Recognition Sequence
CAS :<p>a2b1Integrin Recognition Sequence is a chemotherapeutic drug that is used in experimental models of hyperproliferative diseases, such as cancer. It activates α subunit of integrins, which are expressed on cells and mediate the adhesion to extracellular matrix proteins. The drug binds to integrin receptors on the surface of tubule cells and promotes their death by apoptosis. This protein stabilizes hydrogen bonding interactions between two or more molecules that are present at a site of chemical reaction, thus inhibiting cellular proliferation and tumor growth. As a result, a2b1Integrin Recognition Sequence inhibits the proliferation of human serum albumin (HSA) and basic fibroblast growth factor (bFGF), which are cell culture models for α subunit-integrin receptor interactions. Analysis of the structure of this protein reveals an integrin recognition sequence motif with three invariant residues: Arg-Gly-Asp (RGD).</p>Formule :C14H22N4O9Degré de pureté :Min. 95%Masse moléculaire :390.35 g/molFmoc-D-Ser(BSi)-OH
CAS :<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C24H31NO5SiDegré de pureté :Min. 95%Masse moléculaire :441.59 g/molAnaplasma Phagocytophilum Surface Protein AipA, Recombinant
<p>Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Ehrlichia Canis gp36 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp36 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Suc-Leu-Leu-Val-Tyr-pNA
CAS :<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C36H50N6O10Degré de pureté :Min. 95%Masse moléculaire :726.82 g/molGAP 26 trifluoroacetate salt
CAS :<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>Formule :C70H107N19O19SDegré de pureté :Min. 95%Masse moléculaire :1,550.78 g/molBrucella Abortus Antigen
<p>Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Recombinant Zika Virus NS1 Antigen
<p>Please enquire for more information about Recombinant Zika Virus NS1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>P38 (411-425), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Formule :C59H100N16O20Masse moléculaire :1,353.55 g/molSecretin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C130H220N44O40Masse moléculaire :3,039.4 g/molPRRS-PQGAB-M
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H80N16O23Masse moléculaire :1,309.32 g/molAndrostenedione antibody
<p>The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.</p>Degré de pureté :Min. 95%Prepro-Atrial Natriuretic Factor (104-116), human
<p>Catalogue peptide; min. 95% purity</p>Formule :C61H113N21O20Masse moléculaire :1,460.7 g/molAc-a-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formule :C79H122N18O27SMasse moléculaire :1,788.02 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
<p>Catalogue peptide; min. 95% purity</p>Formule :C53H84N12O16Masse moléculaire :1,145.33 g/molLMP1,TDD
<p>Catalogue peptide; min. 95% purity</p>Formule :C68H102N26O35Masse moléculaire :1,843.72 g/mol[Trp7,β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formule :C41H57N9O10SMasse moléculaire :868.03 g/mol[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C169H263N51O54S2Masse moléculaire :3,937.42 g/molProtein Kinase C Substrate
<p>Catalogue peptide; min. 95% purity</p>Formule :C51H100N22O11Masse moléculaire :1,197.5 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formule :C226H343N61O66SMasse moléculaire :5,002.69 g/molCC Chemokine Receptor 3 Fragment II
<p>Catalogue peptide; min. 95% purity</p>Formule :C114H174N24O43S2Masse moléculaire :2,632.91 g/mol[Nle21,Tyr32] Corticotropin Releasing Factor, ovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C209H343N57O64Masse moléculaire :4,678.29 g/mol[Gln144]-PLP (139-151), Q144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Formule :C66H102N20O18Masse moléculaire :1,463.67 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formule :C32H48N8O14Masse moléculaire :768.78 g/mol
![[Des-Tyr1]-g-Endorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00421.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00600.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00606.webp&w=3840&q=75)
![[His11]Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00676.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Trp7,β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00349.webp&w=3840&q=75)
![[Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00379.webp&w=3840&q=75)
![[Nle21,Tyr32] Corticotropin Releasing Factor, ovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00739.webp&w=3840&q=75)
![[Gln144]-PLP (139-151), Q144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00496.webp&w=3840&q=75)
