Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.118 produits)
- Par Biological Target(99.156 produits)
- Par usage/effets pharmacologiques(6.788 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.748 produits)
- Métabolites secondaires(14.233 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Dog NGAL ELISA Kit
<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>Degré de pureté :Min. 95%Human VDPB ELISA Kit
<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat PAI1 ELISA Kit
<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>Degré de pureté :Min. 95%CA 15-3 ELISA kit
<p>ELISA kit for the detection of CA 15-3 in the research laboratory</p>Degré de pureté :Min. 95%Guinea Pig IgG ELISA Kit
<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>Degré de pureté :Min. 95%Human LRG1 ELISA Kit
<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>Degré de pureté :Min. 95%Human IL12 ELISA Kit (p70)
<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>Degré de pureté :Min. 95%Human SAA ELISA Kit
<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog Red Blood Cells
<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>Degré de pureté :Min. 95%Mouse RANKL ELISA Kit
<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>Degré de pureté :Min. 95%von Willebrand Factor ELISA Kit
<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>Degré de pureté :Min. 95%ENA ELISA kit
<p>ELISA kit for the detection of ENA in the research laboratory</p>Degré de pureté :Min. 95%Human Transferrin ELISA Kit
<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>Degré de pureté :Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Degré de pureté :Min. 95%Human A2M ELISA Kit
<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Rat Thyroxine ELISA kit
<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%PRPF6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF6 antibody, catalog no. 70R-1449</p>Degré de pureté :Min. 95%Human leukotriene E4 ELISA kit
<p>ELISA Kit for detection of leukotriene E4 in the research laboratory</p>Degré de pureté :Min. 95%Dog CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Degré de pureté :Min. 95%KRAS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>Degré de pureté :Min. 95%Coagulation Factor III ELISA kit
<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>Degré de pureté :Min. 95%PGE2 ELISA kit
<p>ELISA kit for the detection of PGE2 in the research laboratory</p>Degré de pureté :Min. 95%Mouse C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Human ApoH (β 2-Glycoprotein) ELISA Kit
<p>Human Apolipoprotein H ELISA Kit</p>Degré de pureté :Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Degré de pureté :Min. 95%Porcine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Degré de pureté :Min. 95%Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control Fc fusion protein
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>Degré de pureté :Min. 95%Hamster CHO PLBL2 ELISA Kit
<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>Degré de pureté :Min. 95%Mouse Retinol Binding Protein ELISA Kit
<p>Mouse Retinol Binding Protein ELISA Kit</p>Degré de pureté :Min. 95%Recombinant Human VEGF-C
<p>Human sequence expressed in CHO Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>ILK-IN-2
CAS :<p>ILK-IN-2 is a molecule that inhibits autophagy in leukemia cells. It has been shown to be effective in inhibiting the growth of meningioma and lymphocytic leukemia cells. ILK-IN-2 has also shown inhibitory properties against chronic lymphocytic leukemia and primary cells, which may be due to its ability to induce apoptosis by activating proapoptotic molecules such as Bax, Bak, and caspase-3. In addition, ILK-IN-2 has demonstrated anti-inflammatory properties that may lead to its use in autoimmune diseases.</p>Formule :C30H30F3N5ODegré de pureté :Min. 95%Masse moléculaire :533.59 g/molHSPG2 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>Histamine ELISA Kit
<p>ELISA kit for detection of Histamine in the research laboratory</p>Degré de pureté :Min. 95%Mouse CRP ELISA Kit
<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Gliadin IgA ELISA kit
<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>Degré de pureté :Min. 95%MTUS1 antibody
<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Human Albumin ELISA Kit
<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human IgM ELISA Kit
<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat C3 ELISA Kit
<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse EGF ELISA Kit
<p>ELISA kit for detection of EGF in the research laboratory</p>Degré de pureté :Min. 95%Salivary Sample Collection Kit
<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>Degré de pureté :Min. 95%Human OPN ELISA Kit
<p>ELISA kit for detection of OPN in the research laboratory</p>Degré de pureté :Min. 95%Bovine Haptoglobin ELISA Kit
<p>Please enquire for more information about Bovine Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%AMC
CAS :<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END></p>Formule :C10H9NO2Degré de pureté :Min. 95%Masse moléculaire :175.18 g/molCSF1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSF1 antibody, catalog no. 70R-6326</p>Degré de pureté :Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Degré de pureté :Min. 95%Human SCF ELISA kit
<p>ELISA Kit for detection of SCF in the research laboratory</p>Degré de pureté :Min. 95%Mesotocin trifluroacetate
CAS :<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.19 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Formule :C35H58N10O9Masse moléculaire :762.91 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%Prolactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molHead activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/mol[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/mol
