Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-8182</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>FAF1 antibody was raised in rabbit using the C terminal of FAF1 as the immunogen</p>

<p>KY1220 is a molecule that destabilizes the activated state of PD-L1, which is a regulatory protein. KY1220 has been shown to enhance the effect of cancer cell death and inhibit metastatic colorectal cancer in mice. It was also found to be more effective than PD-L1 antibodies in reducing tumor size and inhibiting tumor growth. KY1220 has been shown to synergistically enhance the cytotoxic effects of other chemotherapeutic drugs on cancer tissues. This drug may be useful for treating patients with metastatic colorectal cancer or those who are resistant to PD-L1 antibodies.</p>

<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>ELISA Kit for detection of leukotriene E4 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>

<p>ELISA kit for the detection of Human Bax in the research laboratory</p>

<p>Methyltetrazine agarose is a 6% crosslinked agarose resin that is activated with methyltetrazine functional groups for covalent immobilization of TCO-modified biomolecules via a Diels–Alder  reaction. Applications are preparation of protein agarose media with almost quantitative capture of proteins.<br>Activation level: 10-20 µmol methyltetrazine groups per mL resin<br>Bead size: 50-150 µm</p>

<p>ELISA Kit for detection of CEA in the research laboratory</p>

<p>5HIAA ELISA Kit for the quantitative determination of 5HIAA in urine</p>

<p>Purified native Porcine Porcine Liver Esterase protein</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>

<p>ELISA kit for detection of PSA in the research laboratory</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>

<p>ELISA kit for detection of MMP2 in the research laboratory</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant nrdD protein (His tag)</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>Acolbifene hydrochloride is an activator of the estrogen receptor. It has been shown to have a high affinity for the peptide hormone receptors and is an inhibitor of ion channels. Acolbifene hydrochloride is used as a research tool in cell biology and biochemistry, as well as a pharmacological agent in the treatment of breast cancer.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phevamine A is a peptide inhibitor that binds to the β2 adrenergic receptor and blocks the activation of this receptor by its ligands. Phevamine A also has an agonistic effect on G-protein coupled receptors, including the β1 adrenergic receptor. This drug is used in research as a tool to study protein interactions, activator or inhibitor of protein function, and as a high purity reagent for life science applications.</p>

<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC3D antibody, catalog no. 70R-4868</p>

<p>5-Methyl cromolyn sodium is a potent inhibitor of the release of histamine and leukotrienes from mast cells and basophils. It is used to prevent allergic reactions because it blocks the activation of these cells. Cromolyn sodium has also been shown to be an effective treatment for asthma, chronic obstructive pulmonary disease (COPD), and other respiratory diseases. 5-Methyl cromolyn sodium has been shown to inhibit ion channels, which may lead to its antihistamine activity. This drug has been shown to bind with high affinity to a number of receptor ligands including peptides, antibodies, and cell biology proteins.</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>Mouse TNF-alpha ELISA Kit</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>Purified recombinant IYD protein (His tag)</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>ELISA kit for detection of Cystatin C in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>ELISA kit for the detection of cAMP in the research laboratory</p>

<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Ac-Ala-Ala-Ala-pNA is a synthetic peptide that is derived from the natural amino acid sequence of cholecystokinin. It has been shown to have high affinity for phospholipid bilayers, which are lipid membranes that form the boundaries of cells and organelles. Ac-Ala-Ala-Ala-pNA can be used as a substrate molecule to study membrane permeability and selectivity in bioreactors. Ac-Ala-Ala-Ala-pNA also acts as a modulator of liposomal membranes, increasing the permeability of these membranes in order to allow more substrate molecules to pass through them.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Catalogue peptide; min. 95% purity</p>