Produits biochimiques et réactifs

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>ELISA kit for the detection of CRP in the research laboratory</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>

<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>Human KIM-1 ELISA Kit</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>Folic Acid protein is a versatile compound widely used in Life Sciences. It has various applications, including its role as an anti-HER2 antibody in human serum. Folic Acid protein interacts with insulin and epidermal growth factor, making it essential for cellular processes and growth regulation. Additionally, it has been found to have autoantibodies and acidic properties that contribute to its effectiveness as a growth factor. Folic Acid protein also exhibits anti-glial fibrillary acidic properties, which can be beneficial in certain medical conditions. With its unique amino group and carbonyl group composition, Folic Acid protein plays a crucial role in the development of insulins and other Recombinant Proteins &amp; Antigens. Moreover, it has shown promising results when combined with trastuzumab, an anti-glial fibrillary antibody used in cancer treatment.</p>

<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Osteopontin ELISA Kit</p>

<p>5HIAA ELISA Kit for the quantitative determination of 5HIAA in urine</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>(R)-DPN is a selective agonist, which is a chemical compound primarily sourced through synthetic organic chemistry techniques. Its mode of action involves specifically binding to and activating the estrogen-related receptor gamma (ERRγ), a member of the nuclear receptor superfamily. By acting as a highly selective ligand, (R)-DPN modulates the transcriptional activity associated with the ERRγ receptor, influencing various biological pathways.</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>

<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>ELISA kit for the detection of Jo1 in the research laboratory</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>Purified recombinant Human DECR1 protein</p>

<p>ELISA Kit for detection of IFNb in the research laboratory</p>

<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>